KEGG   Nectria haematococca: NECHADRAFT_40790Help
Entry
NECHADRAFT_40790  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
nhe  Nectria haematococca
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    NECHADRAFT_40790
Enzymes [BR:nhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     NECHADRAFT_40790
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NECHADRAFT_40790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 259 aa AA seqDB search
MPQFDESKAYAKQEDTVFFDDGREIELLHYVYGRDDIDELRGSPKRILQAIDEFARTKKY
LMNVGEDKGKIITDLIAEVKPKVMVELGGYVGYSTLLFADAVRSSGGSHYYSLERNPEFA
AVITSLIDLAGLRSVASVIVGPSDKSLSRLHADGTFTKIDLMFLDHYKPAYLSDLKLCER
LRLVGPGTVLAADNVIKPGNPPYLAYVRSSVEEKRAGPKSADEAEGDPNLVYESRLINSF
EPTGIPDGVEITRCTGREN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagtttgacgaatccaaggcgtatgctaagcaggaagacaccgtctttttcgac
gacggccgagagattgagcttctgcactatgtctatggtcgagacgacattgatgagtta
cgtggctcgccgaagcgtattctccaagctattgatgagtttgctcgcacaaagaagtat
ctcatgaatgttggcgaggacaagggcaagattatcacggacttgattgctgaggtgaag
cctaaggtcatggttgaacttggtggttacgtgggttactcgactcttctctttgccgac
gccgtgcgttcctcaggtggttcgcactactattcgcttgaacgcaaccccgagtttgct
gctgtcatcacctcactcatcgacctcgcgggcctacgctccgtcgccagcgtaatcgtc
ggtcccagtgataaatccctctcacgcctccacgcagacggcacctttaccaagattgac
ctcatgttcctagaccactacaagcctgcctacctcagcgatcttaagctctgcgagcgt
ctccgcctcgtgggaccgggcaccgtccttgccgcggacaacgttataaagccaggtaac
ccgccgtatctggcctacgtgcggagcagcgtggaagagaagagggctggaccaaagagc
gcagatgaggcggagggtgatccgaatttggtgtatgagagtcggttgatcaacagcttt
gagccgacgggtattccggatggcgttgaaatcacaagatgcacaggtagagagaattag

DBGET integrated database retrieval system