KEGG   Nectria haematococca: NECHADRAFT_40790Help
Entry
NECHADRAFT_40790  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
nhe  Nectria haematococca
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nhe00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 259 aa AA seqDB search
MPQFDESKAYAKQEDTVFFDDGREIELLHYVYGRDDIDELRGSPKRILQAIDEFARTKKY
LMNVGEDKGKIITDLIAEVKPKVMVELGGYVGYSTLLFADAVRSSGGSHYYSLERNPEFA
AVITSLIDLAGLRSVASVIVGPSDKSLSRLHADGTFTKIDLMFLDHYKPAYLSDLKLCER
LRLVGPGTVLAADNVIKPGNPPYLAYVRSSVEEKRAGPKSADEAEGDPNLVYESRLINSF
EPTGIPDGVEITRCTGREN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagtttgacgaatccaaggcgtatgctaagcaggaagacaccgtctttttcgac
gacggccgagagattgagcttctgcactatgtctatggtcgagacgacattgatgagtta
cgtggctcgccgaagcgtattctccaagctattgatgagtttgctcgcacaaagaagtat
ctcatgaatgttggcgaggacaagggcaagattatcacggacttgattgctgaggtgaag
cctaaggtcatggttgaacttggtggttacgtgggttactcgactcttctctttgccgac
gccgtgcgttcctcaggtggttcgcactactattcgcttgaacgcaaccccgagtttgct
gctgtcatcacctcactcatcgacctcgcgggcctacgctccgtcgccagcgtaatcgtc
ggtcccagtgataaatccctctcacgcctccacgcagacggcacctttaccaagattgac
ctcatgttcctagaccactacaagcctgcctacctcagcgatcttaagctctgcgagcgt
ctccgcctcgtgggaccgggcaccgtccttgccgcggacaacgttataaagccaggtaac
ccgccgtatctggcctacgtgcggagcagcgtggaagagaagagggctggaccaaagagc
gcagatgaggcggagggtgatccgaatttggtgtatgagagtcggttgatcaacagcttt
gagccgacgggtattccggatggcgttgaaatcacaagatgcacaggtagagagaattag

DBGET integrated database retrieval system