KEGG   Nectria haematococca: NECHADRAFT_41715Help
Entry
NECHADRAFT_41715  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 920 aa AA seqDB search
MSNRHLPAGQNIQGGAGGVPGVDMVGGPGGPRRRQAPPYVPQYQQQHHQHHHQHMNPMYG
GYTQFAPQPYYNMPPQYQNTQYQNAQYQHQYLNGQYQNGGMPSPGYMPYQNYARSPPSMH
QYVPMVGVSVPPSYPPRPAQQHSPALSTPYQPPPATAPIPPHTPSSTNSSQMMPPPTPPT
PQTTEPQAPVVPAPAPAPASVPAPAPAPAPAPAREPSPAPKAKEPFRAPLPWLSHPDAEF
PVRTTKSRRRRRLLNADSQAVSLPVEQHEAATEQSEQATIAKTASKEPSIASQTPATSAA
PSETAATPRQPEESAVPVQASSTSQRSRTNTVTSSTSTATSRPATRSSAAPAPALPSLPK
SGAKDAKPARAEKPVNGDVVAETPSQDATSTAAEKLTEPESETAEAPAPAVKLPPSSWAN
LFAKPAAASVAKTGATNGAVAGSATTNGHSAEGVVTATNGSTASFSKANANSVAEAIQSF
NVGLADQLSFLEPRGLINTGNMCYMNSISKRAVHSFKSETPLIDAMIMFMHEFKIIKSAS
SVEPLRRSLKNEELERYGEPFTPEFVYEAIRQLPRFASMRRGHQQDAEEFLGFLLQSLDD
ECTSVMNSSTLAEQSEKANAAEGAAGTSDDWLEVGRKQKAAVTRSAGSNSSSPISKIFGG
LLRSEFRVPGLKDSITTEPYQPLQLDIGSSDVRNVVDALRGLTRPERIQGDFNSPRGKDV
TATKQVFIESLPPVLILHLKRFQFDAEGNGTVKIWKKIGYPLELEIPRDVLSRQKRQTYT
DGAMPKYKLISVVYHHGKNASGGHYTVDVRRQEGREWIRIDDTVIRRVRSEDVAEGGEEE
EVKDTRKDGAVSGSSGSRFDAMTEDAGDEVGWNKVTASTGGAKKWSSVANGASNGTTKAK
PVKDNIKDNKVAYLLFYQRV
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgccatctgccggctgggcagaacatacagggaggagctggtggagtcccc
ggggtcgatatggtcggcggtcctggagggcctcgtcggaggcaggcgcctccgtatgtg
ccgcagtatcagcagcagcaccaccagcaccatcaccagcacatgaatcccatgtatggt
ggctacacccagttcgcgccccagccttactacaacatgccgccgcagtaccagaacacc
cagtaccagaacgcacaataccagcaccagtatctcaatggacagtaccagaacgggggt
atgccctcgcctggctacatgccgtaccagaactacgctcggtcgccgccctccatgcac
cagtacgttccgatggtcggcgtgagcgtgccgccaagctaccctcctcgtcctgctcaa
caacattctcctgcgctctcgactccctaccagcccccgcctgcgacggctccgattccg
ccccatacgccatcatccaccaactcctcccagatgatgcctcccccgactccgccgacg
ccgcaaactacagagccgcaagctcctgtcgttcctgctcctgcccctgctcccgcttct
gttcccgctcccgctcccgctcctgctcctgctcctgcccgggagccttcgccggctccg
aaggcgaaagagcctttccgtgctcctcttccttggctttcccaccctgatgccgagttt
cctgtcagaaccaccaagtcacgacggaggaggagactcttgaacgcagacagccaggct
gtatccttgcccgtcgagcagcacgaggccgccacggagcagtctgaacaagcaaccatt
gccaagacagcgtcaaaagaaccatcaattgcttcccagacccctgcgacgtccgcggcc
ccatccgagactgctgcaacccctcgtcagcccgaggagtccgccgttcccgttcaagct
tcctctacttctcaacggtcccgcaccaacactgtgactagcagcacctcgacggccacc
agcagacccgccacgcgctcctccgctgcccctgctcccgctcttccttctttgcccaag
tctggtgctaaggacgccaagcctgctcgtgctgaaaagccggtcaatggcgatgtggtt
gccgaaactccgtctcaggatgcgacgtctactgctgccgagaagctcaccgagcctgag
tccgaaactgcagaggcgcctgctcctgctgtgaagcttccaccctcaagctgggctaac
ctttttgcgaagcctgccgccgcatccgtcgcaaagactggtgctaccaatggtgctgtt
gctggcagcgctactaccaatgggcatagtgcggaaggtgttgtcactgccacgaatggc
tctactgccagtttctccaaggccaatgccaactcggttgcggaggccattcaatctttc
aacgttggtcttgctgaccagctttcgttcctcgagcctcgcggcttgatcaacaccggc
aacatgtgttacatgaactcgatcagcaagcgagctgtccatagcttcaagagcgagaca
cctctcattgacgccatgatcatgttcatgcatgagttcaagatcatcaagtctgcttct
tcagtcgagcccctgcgccgctctctgaagaatgaggagttggagcgctatggcgagccc
ttcactcctgagtttgtctacgaagctataagacagctgcctcgtttcgcaagcatgagg
cgaggtcatcaacaagacgccgaagagttcctgggtttccttctccaatctctcgacgac
gagtgcacttctgttatgaatagctccactctggcggagcagtcagagaaggctaatgcc
gctgagggggctgctggtacatctgatgattggcttgaggttggcaggaagcaaaaggca
gcggtgacccgatccgctggatccaactcatcgagccccatctccaagatctttggcgga
ttgcttcgatcagagttccgcgttcccggactgaaagactccatcaccactgagccctac
cagccgctccagttggatattggatcttcagatgtacgcaacgtggttgatgcgctccgg
ggcctcacccgccctgagcgtattcagggtgacttcaactcaccccgaggcaaggacgtg
acggccaccaagcaggtcttcattgagtcgcttcctcccgttctcatcctgcacctcaag
cgattccagttcgatgcggagggcaacggaaccgtcaagatctggaagaagattggatat
cctttggagctcgagattcctcgtgacgtattgtctcggcagaaacgccagacatacacc
gacggagcgatgcccaagtataagctgatcagtgtggtgtatcaccacggaaagaacgcg
agcggtggacattatacggttgatgtgcgccgccaagaaggccgtgagtggatccgtatc
gacgacacggtcattcgcagggtgcgaagtgaggatgtggccgagggcggcgaagaggaa
gaggtgaaggatactcgcaaggatggcgctgtttctggtagctcgggcagccgtttcgat
gccatgacggaagacgcaggggatgaagttgggtggaacaaggtgacggcttccactgga
ggagccaagaaatggagcagcgtcgccaatggggccagcaacggcactaccaaggcgaag
ccggtcaaggacaacatcaaagacaacaaggtggcgtacctgctgttctaccagcgggta
taa

DBGET integrated database retrieval system