KEGG   Nectria haematococca: NECHADRAFT_42178Help
Entry
NECHADRAFT_42178  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:nhe01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:nhe00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 519 aa AA seqDB search
MRNTKIDLDAEEAAFLDLADSIEQEWQSPRQAHLKRPYSAKTIAALRNTIPISYPSSLQG
DKLWDLLNEHLKNGTHEKTFGTTEPTVVSQMVKHQQTVYVSGALCGLSEVQHPGCDHADY
PWDTVPKVVEKIFKAQLWHDQRQKQFRLHHTKAEREKLEAYDFMAPIIADGDMGFGGLTS
TVKMTKLFVEAGVAMIHLDDLAIGLKKFTIGEGRTVVPTSEYIARLTAVRMQFDVMGVNT
LLMCRCDTDRSQFITSTIDPRDHEYILGATHDVKPLVEAVSSGMAEGKTYMQARDEWKAS
AGLMTFDEAVKARCNEQKYQQYLAKASVYGTSLKDRRRFAKDAVGEDVVFDWELPRSKEG
QYMWKPSVKTIVERAVAAAPLGDMTWARMDAPVWRDILEFHTEVRKIFPDRLFAFGFTGM
YDYTKAGFTDEQIRSFSDDMAKLGIVWQVQPIWAVGGLNMTAEKFAKEWQQDGIAGYIEK
ISKPSRAPPIVDGFHKPSYAGSYLADAFFAAVAGQEITP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacactaaaatcgatctggacgccgaggaagcagcgtttctggaccttgcggat
tcgatcgagcaggagtggcaatctcccagacaggcacatctgaaaagaccctactcagcc
aagacaattgccgcgttgcgaaacacaatccccatctcgtacccatcgagcttgcaaggc
gataagctttgggatctcttgaatgaacacctgaaaaatggtacccatgagaagacattt
ggtacgaccgaacctaccgtggtttcccaaatggtcaagcatcaacagactgtgtacgtc
tcgggggcactttgcggtctctcggaagttcagcatccgggctgcgatcatgcagactac
ccatgggacacagttcccaaggttgtcgagaagatcttcaaagcccaattgtggcacgac
cagcgccagaagcagttcagattacaccacacaaaggctgagcgggagaagcttgaagct
tacgacttcatggcgcccatcattgccgatggcgacatgggcttcggaggcctgacctcg
acggtcaagatgaccaagttatttgtggaggcgggagtcgccatgatccacctggatgat
ctcgccattggcttgaagaaattcacgattggcgagggccgaaccgtggtgcctaccagc
gagtatatcgctcgcctcacggccgttcgcatgcaattcgatgtcatgggtgtcaatacg
ttactgatgtgtcgatgtgatacagaccgttctcaattcatcacgagcacaattgatccg
agggaccatgagtacatcctaggcgccacccacgacgtgaagcctctcgtggaggcggtc
tcatcgggaatggctgagggcaagacgtacatgcaggcacgcgatgaatggaaggccagc
gcaggcttgatgacctttgacgaggcggtcaaggccagatgcaacgagcagaagtaccag
cagtatctggcaaaggcttccgtgtacggcacgtcactcaaggatcgacgccgattcgcc
aaggatgctgtaggagaggacgttgttttcgactgggagctgccgaggtccaaagagggc
cagtatatgtggaagccaagcgtcaagacaatcgtagagcgagctgttgcagctgctccc
ttgggagacatgacttgggcaagaatggatgcgccagtctggagggacattctcgaattc
cacacggaagttcgtaagatctttcctgatcggctctttgccttcggattcaccggcatg
tacgactatacaaaggccggtttcactgatgagcaaatccgctccttcagtgacgacatg
gccaagctgggcattgtttggcaggtccagccgatctgggctgtcggcgggcttaacatg
acggctgagaaattcgcaaaggagtggcagcaagacggcatcgcggggtatattgagaag
atttccaaaccgtccagggcgccacccattgtggatggattccacaagcctagctatgct
ggatcttatctagctgacgctttcttcgctgccgtggctggtcaggagatcacgccgtag

DBGET integrated database retrieval system