KEGG   Nectria haematococca: NECHADRAFT_4540Help
Entry
NECHADRAFT_4540   CDS       T01612                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
nhe  Nectria haematococca
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NECHADRAFT_4540
Enzymes [BR:nhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NECHADRAFT_4540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 452 aa AA seqDB search
MHNPTSSLLVTLTAALAALPAADAAIYTKNSPVLQLNAKTYDKLIAKSNYTSIVEFYAPW
CGHCQNLKPAYEKAAKNLEGLAKVAAIDCDDDANKPFCGSMGVQGFPTLKIVRPGKKYGK
PVVEDYQGQRTAGAISEAVSSKINNHVTRVSDKDLDSFLGGDKPKAILFTKKGTTSALIR
SIAIEFLDVISVAQIRDKEKAAVEKFGIKDFPTLVLVPGDGQEPILYNGELVKKDMVKFL
SQAAQPNPDPAPDNGKASKAKSNGAKSKKSKSTETVKEEPTAEPESASEAAESAIPSIVP
IDTITSLEKLTEECLAPKSHTCILVFTPGEAGEKAVDSLSHLNTKYVHGGRHTFPIISIP
SDSEAASTVPKALGLSDEVNLIAINTRRNWWRQYQGDFSLHSVENWVDTIRMGEGAKKKL
PEDFNAEPKAEGAKEEATQATDPEPEVETEAP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcataaccccacctcttctctgctggtgacgttgacggcagcgctggcggctctgcct
gcggctgacgctgccatctacaccaagaactcgcctgttttgcagttgaacgcaaagact
tatgataagctcattgccaagtccaactacacttcgatcgtcgagttctacgccccttgg
tgtggccactgtcagaacctcaagcccgcctacgaaaaggctgccaagaaccttgagggt
ctcgccaaggtcgcggccattgactgcgatgatgacgctaacaagccattctgtggctcc
atgggcgtccagggtttccctactctcaagattgttcgtcctggtaagaagtacggaaag
cctgttgtcgaggactaccagggccagcgaactgccggtgccatcagcgaggctgtctcg
agcaagatcaacaaccatgtcacccgagtgagcgacaaggatctggattctttcttgggt
ggtgataagcccaaggctatcctgttcaccaagaagggaaccaccagcgctctcatccga
agtatcgccattgagttcctcgatgtcatttctgtggcccagattcgtgataaggagaag
gctgcggttgagaagtttggcattaaggatttcccgactcttgtcctcgtcccaggtgac
ggccaagagcctatcctctacaacggagagctcgtcaaaaaggacatggtcaagttcctc
tctcaggctgctcagcctaaccctgaccctgctcccgacaatggcaaggcttccaaggct
aagagcaacggagccaagagcaagaagagcaagtcgaccgagactgtcaaggaggagccc
accgctgagcccgagtccgcttccgaggcagctgagtctgccatcccctccatcgttccc
atcgacaccatcacttcgcttgagaagctcaccgaggaatgcctcgcccccaagtcccac
acttgcatccttgttttcactcccggagaggctggcgagaaggctgttgactccctgtct
catctcaacaccaagtatgtccacggcggacgacacaccttccccatcatctccattccc
agcgatagcgaagctgcttcgactgtgcccaaggctcttggtcttagcgatgaggtcaac
ctgatcgccatcaacacacgccgaaactggtggcgtcagtaccagggcgactttagcctc
cacagtgtcgagaactgggttgacaccatccgcatgggcgagggtgccaagaagaagctc
cccgaggactttaacgctgagcccaaggccgagggcgccaaggaggaggccactcaagct
accgaccctgagcccgaagttgagaccgaagcccct

DBGET integrated database retrieval system