KEGG   Nectria haematococca: NECHADRAFT_45554Help
Entry
NECHADRAFT_45554  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 9666109
NCBI-ProteinID: XP_003049202
JGI: 45554
UniProt: C7YWX9
Position
7
AA seq 424 aa AA seqDB search
MPRDKAPQDSDGVSLKLAEATSSPPSGGPRAWLNVLGSFMLYFNTWGILNTFGAYQTYYE
SGELFDASSSDISWVGSIAAFLLLFVGIFVGPVFDRGYLRTLLLVGSFMVVFGHMMLSLC
DSLWQVLLAQGFVIGIGAGCLFVPCVAIIPQYFSTRMGTALGIAASGSALGGVIYPIVLY
RLIGEIGFPWTTRVIGFIVLGTLLIPIVTMRLRVQPPKIRAMVDMTTFTDVSYMAFVLNS
MLAYMGLFVIFFYLSYYAAAEHITDDSLAFYLVPIFNAASVFGRTIPNKLADKTGPFNLL
APFSCVSGALMLCMMAVHSKGAITVLAILSGFMSGALIGLPPICLAVLTKDKSRLGTRIG
MGYAIIALGVLISGPSGGAILSGNGNTLHWHNLWTFGGVPTCLSGLGYAAIRVSIYGAKL
RVKA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccccgagataaggccccacaagactccgatggtgtctctctcaaacttgctgaagcg
accagctctcctccgagcggtggcccccgagcctggttgaacgtcctcggaagtttcatg
ctctacttcaacacttggggcatcctcaacacctttggtgcctatcaaacgtactacgag
tctggagagctcttcgatgcgagttcctcggacatatcctgggtcggatcgatcgctgcc
ttcttactgctgtttgttggaatattcgtcggccccgtcttcgaccgcggttatctacgc
actctactcctcgttggaagcttcatggttgtctttggtcatatgatgctcagtctctgt
gattccctctggcaagtcctgcttgcccaaggctttgtcataggcattggggctggctgc
ctgtttgtcccttgcgtcgccatcatccctcaatacttcagtacgagaatgggcactgct
ttgggaattgctgcgtctggatccgccctgggcggtgttatctatcccatcgttctctat
cgactcatcggcgagattggattcccctggaccactcgcgttattggcttcatcgtgctg
ggtaccctattgatacccattgtcaccatgagacttcgagttcaaccccccaagattaga
gccatggtcgacatgaccaccttcaccgatgtcagctacatggcctttgtccttaattcg
atgctcgcttacatgggccttttcgtcatcttcttttacctatcctactacgccgcagca
gaacacatcacagacgattctctcgcattttatctggttcccatcttcaacgccgcgtca
gtgtttggccggacgatacccaataagcttgccgacaagacaggtcctttcaatctcctg
gcgccgttttcttgcgtctctggagccctgatgctctgcatgatggcagtacactccaaa
ggcgccattactgttctagctatactctctggtttcatgagtggcgcacttattggcctt
cctccaatatgtcttgcggtcctgaccaaggataaatctagactcggaactcgaatcggt
atgggctatgccatcattgctctgggtgttctcatcagcggcccaagtggtggagctatt
ctaagcggcaatggaaacactttgcactggcacaacctgtggacgtttggtggtgtgcct
acttgtctttctgggttgggttatgccgctattcgtgtgtcgatttacggtgcaaagctt
agggtgaaggcataa

DBGET integrated database retrieval system