KEGG   Nectria haematococca: NECHADRAFT_46470Help
Entry
NECHADRAFT_46470  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:nhe03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1643 aa AA seqDB search
MAEITALDALQAFHQGLLSLREGRVEGAEALNNEFLVQVFETELGKLWDKPARNEKNRNA
VTSGKVVIDGDEYSINDGFQQDVLTLSDEVELDELEATRCVLESQEDPSTLGRSLLECAI
IRFHQQRKYVLDIVRLLLEIDGLDEDMADPEALESRIVPRCMASMREIKAWLQKIGDKIA
AAQTLGQSTNGMSEQMETIEFSRVSLIQQHELVGVILCRSVEMRQGSTADFLDFVAALKR
MDKYDALLVHLIPSIGAYISVFGSAEGGYDLIKARELHGKLFPADDTPWPLSQLHAAFRS
WWLAEYSGFYVDDPPEAAIPPNTDLDEEDRQRSKLFLEALKDGSFDFLLSIAADVKSPDW
HDPVRAGMRKWLQRKSPALAPDAIPFSEFFQATLMLQLEVFVDAFISNLPDVLRKLRVEE
DEQRQSSQTHEQDLDLERFLLVIAYSYEGRPEAAMNFWSDPDSNLAGFMHWASRRASTPL
VTAFCEMLQAISENEECASAAHEFLVDEGHHSSGKMRKSQSLTWAQIFRELDFFSAKIRQ
KPTPTQTIRYRNDKLSSDQAETEPESAMMLECYLRLMSKLASESETTRHFLLHNPNYNLV
ETLYELASSPIPPRLRGCTFMALRALMARKSLQEGHVMWSCLDTWITGGYASHATGPHRQ
AQQSPTVSMDRIFDEISNGFEDPESFIQLLLSLVCPAIDSSPLNDGLPFPENLGSAFRMP
GIEVYVDFVMGLVLATKSNDLQDANQTRVLRLSCLDFILICLTTFNEDLIIMANETNINV
DAVISTTDLATYVRMHPFARVMEWMFNDKVMTALFNTIHQEPVDVGNAAPDSPLILGILR
AVEVISKVLDLQATYLELVRPILKAQSSQRRPPVANAAFSSFEDGLVTRLNLVVDLGNYC
GIGHPELTLACLKLLEKMSSSSKITAIWSGSNRQAHRNKAIVALEANGEHEAISRSFVSE
LITPLEAGREADSPAYITKIYILDFLYQCLQETPRKPTIAHLLLGFKCSIDSLSIDAKGS
FASRTSLFHTLLRLLLEAPSGDAQGMRQWLVAIKSRVMRILHILWSSPLSAPIVVEELRE
NEILFHLLLREVVINPDLPWEGENVAVVHFPVTEGAVTLIDFMALRRMGLEYIAMELCSI
SQSRMPSLKRRIFEALNGQIIGEGNAPIQIPTIFDLYDFLLPEGAWEIPLPPLQYYKDID
LSACLENDADSNPIYNLDRVKEILLLKRGEAQGSGALVAAQDLAAIEREEAMILEYLVSS
NRQKQLSTQSLKVLKTWTKLLLVMIESNDFKGSAQTSFFLQALQSILPSLEAFASERPAE
ALELARLAKILLFKLDLSAPAEDKQGSAIGNLVSDKLYQLFQICLQAIGKWAGTPELRSV
YYGICYRYLAGMSDQGALTSNRPKTIKTIQVYGERLINVICDDAYGGEAQCQTAALILLN
ALVSMGRQENEDHVVETLNRLNFIGILVDSLRNIMHEWHEVFGSNNSEQENYQNARLALL
LELSQTRSGAKYLLHSNLFRALELSGLFTADPELQINTANPRALEQHYDLLAQVVRIIGA
ALVSRGSHNVVQGRRFLSEHRMLVTHSLKRSAGIGSGNADDGLDSKIEELAEGLMVIIAA
TRFLEFENEVIPEPKQPTHGLFH
NT seq 4932 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaccgctttagatgccctgcaagctttccaccaagggcttctatcatta
cgcgaaggtcgcgtcgaaggcgccgaggctctcaacaacgaattcctcgtccaggttttc
gagacggagctaggcaagctctgggataagccggcaaggaacgaaaagaaccgaaatgca
gtcacgtctggcaaggttgtcattgacggagacgagtactcgataaacgatggtttccag
caagatgtcctcaccctatccgacgaagtcgagcttgacgaactcgaggctacgcgatgt
gtcctcgaatcgcaagaagacccttccacgttgggccgatccctcctcgaatgcgccatc
atccgatttcaccagcagcgcaagtatgttctagatattgtgcggctgctcctcgagata
gacggcctcgatgaagacatggccgatcccgaagcgctcgagagtcgaattgtgcccagg
tgcatggcgtccatgagggagatcaaggcatggcttcagaagattggggacaagatcgcc
gccgcccaaacacttggacaatcaacgaatggcatgtctgaacagatggagacaatcgag
ttctcccgagtcagtctgattcaacaacacgagctcgtgggtgtcatcctctgccgaagc
gtcgagatgaggcaggggtcaacagcagattttcttgattttgtggcagctcttaagagg
atggacaagtatgatgctctgctggttcatcttattccgtcaattggagcgtacatctca
gtttttggatctgctgaaggaggatatgacttgatcaaggctcgcgagcttcacggcaag
ctctttcccgccgacgatacaccatggccactatcgcagctacatgcagctttccgctct
tggtggcttgcggagtacagtggcttctatgttgatgatcctccggaggctgcgattcct
cccaatactgacttggacgaggaggaccgtcagcgatcaaagctattcctagaggctctc
aaggatgggtccttcgattttctactctccatcgctgcggatgtcaagtctccagattgg
catgaccccgtcagagcaggcatgcgcaagtggctgcagcgaaagtctcccgccttagca
cccgatgccattccattttcagagttctttcaggcaacgctcatgcttcagctcgaggtg
ttcgttgacgcatttatctctaaccttcctgatgtgctccgaaagcttcgcgtggaggaa
gatgaacagcgccagtcgagccagacgcacgagcaagatctagacctggaacgattcttg
ctcgtcattgcctactcatatgaaggccgcccagaggctgctatgaacttctggtctgac
ccggatagtaacctggccggattcatgcactgggcttcccgaagagcctccacgcctctg
gtgaccgcgttctgtgagatgcttcaggccatttcagaaaacgaagaatgtgcatccgct
gcgcatgagtttctagtcgatgaaggccatcattcatcaggaaagatgcggaaatcgcag
tctctgacctgggcgcagatttttagggaactcgacttcttctccgccaagatcagacaa
aaaccaactccaactcagacgatacgatatcgaaacgacaagctcagcagcgatcaggcg
gagacagaacccgaatcagccatgatgcttgagtgttaccttcgtttaatgtcgaagcta
gccagcgaaagtgaaacgacacggcacttcctccttcacaaccctaattacaacctcgta
gagaccctctacgagctcgcaagcagcccgattcctccccgactgcgcggctgcaccttt
atggctctacgagcattgatggcacgcaagtcgctccaggaaggccatgtgatgtggagc
tgtctggatacatggatcacagggggttacgcttctcatgcaacaggacctcatcgtcag
gcccagcaatcgccgactgtgtccatggatcggatctttgatgaaattagcaatggattc
gaggatccggaatccttcattcaattattgctctctttggtctgtccggccattgacagc
agccccttgaatgacgggctccccttcccagaaaaccttggttctgcattccgcatgccc
ggtattgaggtttatgtcgactttgtcatgggccttgtgttggccacgaaatccaatgat
cttcaggacgcgaatcaaactcgggttctccgtcttagttgcctcgacttcatcctcatc
tgcctgaccacattcaacgaggacttgatcatcatggccaacgaaacaaatattaacgtc
gatgcagtcatctcgactaccgatctggcaacatatgtacgcatgcatccgtttgcgagg
gtgatggagtggatgttcaacgacaaagtgatgacggcacttttcaacacgatacatcag
gagcctgttgatgtgggaaatgccgctcctgactcacccttgattctcggtatcttgcgt
gctgtcgaggttatctccaaggttctcgatctacaggccacctaccttgagctcgtccga
cccattctcaaggcccagtccagccaacgtcgaccgcccgtagcgaatgctgccttctct
tccttcgaagatggtctcgtcactagactgaatctcgttgttgatttaggaaactactgt
ggcatcggacaccccgagcttacactggcatgcctcaagcttctcgagaagatgtcttct
tcatccaagatcaccgcgatttggtcaggatctaacagacaggctcatcgcaacaaggcc
atcgttgctctggaagctaacggtgagcatgaggcgatttctcgatccttcgtctcagaa
ctcatcaccccgttggaggccggccgagaggcagattcgccggcgtacatcaccaaaatt
tacatcctcgacttcctctaccagtgccttcaggagactccccggaagcccacaattgca
cacttgctacttggcttcaagtgcagcattgactctctgtcgattgatgctaagggctct
ttcgcttccagaacgtccttgtttcacactctcctgaggttgctcctggaagctccctca
ggcgatgctcaggggatgcgacaatggctcgtcgctatcaagtccagagtgatgcgcatt
ctccacatcctctggagctcgcccctatctgctcctattgtggtcgaggaactacgcgaa
aacgagattctcttccacctccttctccgtgaggttgtcatcaatccggatctaccatgg
gagggagagaatgttgccgtggttcacttcccagtgactgaaggcgcagtgaccctgatc
gacttcatggcgctccggaggatgggtctggagtatatcgctatggagctttgcagcatc
tctcagagccgcatgccgagtctcaagaggcgaatctttgaggctctgaatggccagatc
ataggggagggcaacgccccaatccaaatacctaccatcttcgacctctacgatttcctg
ctcccagaaggcgcgtgggagattcctctaccccctctccagtactacaaggatattgat
ctgtcagcatgcctggagaatgatgccgactcaaaccccatctacaacctcgatcgcgtc
aaggaaatcctgctcctaaaacgtggcgaggctcaggggtcaggggcgctggttgctgct
caggaccttgccgctatcgagcgagaagaggctatgattcttgagtaccttgtctcctcc
aaccggcaaaaacagctttccactcagagcctgaaggtcctgaagacatggacgaagctg
ttgcttgtcatgattgaatcgaatgacttcaagggctctgctcagacatccttcttcttg
caagcgctccagtcgattctccccagtcttgaagccttcgcgtccgagcgaccagctgaa
gccctcgagcttgcaaggctcgccaagattcttctcttcaagctcgacctctcggcgccc
gctgaggacaagcaaggctcggcaattggcaatctagtgagtgacaagctttaccagctt
ttccagatttgccttcaggccattggcaaatgggctggcacaccagagctcaggtcggtc
tactacggcatctgctaccgctacctggcgggcatgtctgaccaaggtgctctcacgtcc
aaccgccccaagaccatcaagactatccaggtgtatggcgagcggctgatcaacgtcatc
tgtgatgatgcctatggtggtgaagcgcagtgccagacagcagccctgatcctcctcaac
gccttggtcagtatgggtcgtcaggagaacgaggatcatgtcgtcgaaactctgaaccga
ctaaactttattggaatcctggtcgattcactacgcaacatcatgcacgagtggcacgag
gtcttcggttccaacaactcggagcaggagaattatcaaaacgcacgcctcgcgctcctg
ttggagctatcgcagactcgttctggtgcgaagtaccttcttcactccaacctcttcaga
gcactcgagctctcgggtctattcacggcagaccctgagctccagatcaacacggccaac
ccgcgtgccctcgagcagcactacgatcttctcgcccaggttgtgcgcattatcggcgcc
gcgctcgtgagtcggggcagccacaacgtggtgcagggccgcaggttcctctctgagcat
cgcatgctcgtgacacactctctcaagcgcagtgcaggcatcggcagcggtaatgccgac
gatggtctggactcgaagattgaggagttggcagagggtctgatggttatcattgcggcc
actcggttccttgagtttgagaacgaggtcatccccgagcctaagcagccgacccatgga
ctcttccattag

DBGET integrated database retrieval system