KEGG   Nectria haematococca: NECHADRAFT_46783Help
Entry
NECHADRAFT_46783  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nhe  Nectria haematococca
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NECHADRAFT_46783
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NECHADRAFT_46783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 392 aa AA seqDB search
MKSSALLNLLALTGLASACAHDHDDKEWTKEELDELEAKWGYEWPFAGINTFAHLNHVKC
LTEPTEPFDIAIVGAPFDTAVSYRPGARFGPRAIRSASARQTSFRGFNPRAGINPYQNWA
KIVDCGDISITPLDNNIAQEQMTQAFKQLGKRKTVSSLAPKPKLMTLGGDHSLALPALRA
LNHIYGKPIQVLHFDAHLDTWNPAAYPSWWGASQFTHGSMFWMANQEGLLSNSSSEASVH
AGLRTRLSGDDFADNEDDTSQNWVRFTADDIDEIGTKGIIDGILKVLGTENPVYLSVDID
VLDPAFAPGTGTPEPGGWSTREFIRILRGLEGLNLVGADVVEVSPAYQNGGEETALAAAQ
VVYEIISSMVKRGLADGGKEAKTAGSAGKDEL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcttcagctctcttgaacctgttggccctgacagggctggcctcagcctgcgct
catgatcatgacgacaaggagtggaccaaggaggaactggatgagctcgaggcgaaatgg
ggctatgagtggccctttgctggcatcaacacctttgcccacctgaaccacgtcaagtgc
ctcacagagcccaccgagcccttcgatatcgccatcgtcggtgctccctttgacacagct
gtcagctacagaccgggcgcacgcttcggtccccgtgccatccgctccgcctcggcacgt
cagacgtcgttccgcggcttcaaccctcgcgctggcatcaacccctaccagaattgggcc
aagatcgtcgactgtggcgatatcagcatcactcccctcgacaacaacatcgcacaggag
cagatgacccaggccttcaagcagctcggcaagcgaaagaccgtatcttccctggcaccc
aaacccaagttgatgactctgggcggtgatcacagtctggcgctgcctgctttgagagcc
ctgaatcacatttatggcaagcctatccaggtcttgcactttgatgctcacctcgacacc
tggaatccggctgcctacccatcttggtggggagcctctcaattcacccatggttccatg
ttctggatggccaaccaggaaggtcttctctccaactcgtcctccgaggcctctgttcac
gccggcctgcgcactcgcctctcaggcgacgattttgctgacaacgaggatgacacctcg
cagaactgggtccgcttcactgctgatgacattgacgagatcggcaccaagggtatcatc
gacggtatcctcaaggtcctcggcaccgagaaccccgtctacctgtctgtcgacatcgac
gtcctcgacccagcctttgcccctggtaccggtactcctgagcctggtggctggtcaacc
cgcgagtttatccgcattctgcgcggtctcgaaggtctcaaccttgttggtgctgacgtc
gtcgaggtgtcgcctgcgtaccaaaacggcggagaggagaccgccctggctgcagctcag
gttgtgtacgagatcatctcgtccatggtgaagcgaggactcgccgatggtggaaaggag
gccaagaccgctggctctgccggaaaggatgagctgtaa

DBGET integrated database retrieval system