KEGG   Nectria haematococca: NECHADRAFT_46820Help
Entry
NECHADRAFT_46820  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K03350  anaphase-promoting complex subunit 3
Organism
nhe  Nectria haematococca
Pathway
nhe04111  Cell cycle - yeast
nhe04113  Meiosis - yeast
nhe04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NECHADRAFT_46820
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NECHADRAFT_46820
   04113 Meiosis - yeast
    NECHADRAFT_46820
Protein phosphatases and associated proteins [BR:nhe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NECHADRAFT_46820
Ubiquitin system [BR:nhe04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     NECHADRAFT_46820
Chromosome [BR:nhe03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    NECHADRAFT_46820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_14 TPR_19 TPR_8 TPR_16 TPR_11 TPR_12 TPR_17 TPR_7 TPR_9 Muraidase TPR_20
Motif
Other DBs
NCBI-GeneID: 9665623
NCBI-ProteinID: XP_003048776
JGI: 46820
UniProt: C7YYV2
Position
8
AA seq 821 aa AA seqDB search
MAPTPTAISGLIRQVIHYHLDNASYENALFFAERLTAQDPRSSEPTYLYALCHLRLGDYR
SAYDVSKPMGYRGVHFGCAWVFAQACLALERYKDGITALEKSRSLWSSKSCLGKHSATTR
TALPDASAVLCLMGKLNRGYDDKKKAIGCFEESLKLNPFMWDAFTALCEMGVTVRVPNIF
KINDALVQSFDVEPSSSVDSREGSVSNPPEVPTKKSQRGVATDIGSDPFNPSNSPTIHEL
TNGDSAMESERSDFMLKIHEGRMRYATTTNNSGFDGMETPPSQGLSEVTSSRAVQPHDAP
QAPSRRTRNMHAMDQGHDAPPRMNYRLGSRRTRAQDKGQQEQAAEVVMADASNGAPSAPL
RSSIPAAERKRTVSGHPARGPEEPTTTRRSARLNMFRPSSKANSGAATIGASAGRELKKA
RPPISRIVRPGSSGSSVGRVVSGNRKPLEDAHADVDHGELPKVKEVPPQPPAPKPAELDT
QRIEEGLKWILDLTKKLANGYYSLSQFQCAESVQALMSLPLAHQNTPWVLAQMGRAHYEQ
ASYADAEKFFRKMRVQAPSRLEDMEVYSTILWHLKRETDLSFLAHELVDSAWLSPQAWCA
LGNAWSLARDYEQALKCFKRATQLDPKFAYAFTLQGHEHVANEEYDKALTAYRQAISADR
RHYNAYYGIGKVQERLGALDKAYAHFHAAQMINPNNAVLICCIGTVLEKQKQIMPALQAY
SKAVELAPRAAQTRYKKARALLAVGQLDAAQKELMVLKDLAPDEATVHFLLGKLYRSMGE
KQLSVRHFTIALALDPKASQQIKEAIESFEDDVDMDDSMMA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccactccgacagccatcagtggcctgatacgacaggtgatacactatcatctc
gacaatgcctcatatgaaaacgccctcttcttcgccgaacggttgaccgcccaggacccc
aggtccagcgaacccacatacctctatgcgctatgtcatctgcgcctcggcgactaccgg
tcggcatacgacgtcagtaaacccatgggctaccgtggtgttcactttggctgcgcgtgg
gtgtttgcgcaagcctgcttagccctcgagcggtacaaggatggcatcacagcccttgag
aagtcgcggagtctctggtcgtcgaaaagttgccttgggaagcatagcgcaaccactcga
acagctcttcccgacgcatccgcagtgttgtgtttgatgggcaaactcaatcgcggctat
gacgacaagaagaaggctatcggctgcttcgaggagtcgctcaagctcaaccccttcatg
tgggatgcctttacagcgctctgcgaaatgggcgtgacggttcgcgtgccaaacatcttc
aagatcaacgatgcgcttgtgcagagtttcgacgtggagccgagctcgtcggtagactca
agagaaggatcagtatcaaatcccccagaggttccgacaaagaaatcacaacgaggcgtc
gcaacggatatagggagtgacccattcaatcccagcaactctcctaccatccacgagttg
actaatggcgactctgctatggaaagtgaaaggagcgactttatgttaaagattcacgaa
ggtcgcatgcgctatgcaactacaaccaacaattctggctttgacgggatggagactccc
ccgagccaaggattatcagaggtaacatcctctcgcgctgttcaaccacatgatgcgccc
caagcgccttcacggaggacgcggaacatgcacgccatggatcaaggtcatgacgcacca
ccacggatgaactatcggttaggatcaaggcgaacgagagcgcaagacaaaggacaacag
gaacaggctgctgaagttgtcatggcggatgcatctaatggcgccccctcagcacctctg
cggtcgtccataccagcagcggagaggaagcgcactgtatcaggacacccagcacggggt
cctgaggagcccacgacgactcgacgcagcgcaagactgaacatgttcagaccatcatcc
aaagcaaactcgggcgcggccacgataggagcgtcggccggtcgagaattaaagaaagct
aggcccccgatctctcgaatagtacgaccaggatctagcggttccagtgtcggacgagtc
gtcagcgggaaccgcaaacctctggaagacgcacacgcagatgtcgatcacggggaactg
ccaaaggtcaaggaggtacccccccagccgcctgctcccaagccggcggaactggacacg
caaaggatcgaggaaggacttaagtggatactcgatcttacaaagaagctcgccaacggc
tactactctttgtcacagttccagtgtgccgagagcgtgcaagccctgatgtcgctacct
ctggcgcatcaaaacacaccatgggtacttgcgcagatgggccgagcacactacgagcag
gcttcatacgccgacgccgaaaagttctttaggaaaatgcgtgtccaagccccgtcacgg
cttgaggatatggaggtgtattctacgattctctggcatctgaagcgagagacggatctc
tcattccttgctcatgagctggtagactctgcctggctctcaccgcaagcctggtgtgca
cttggcaatgcgtggtcgctcgctcgcgactatgagcaagcattgaagtgtttcaagagg
gcaactcagctggatcccaagttcgcctatgctttcacattacaaggacacgaacatgtg
gccaacgaagagtatgacaaggccctcacggcataccgacaggcgatatcggcagataga
cgccactacaacgcttactacggcattggaaaggttcaagagcgcctgggtgcgctcgat
aaggcgtacgcgcacttccacgcagctcagatgataaaccccaacaatgcagtcctgatc
tgttgtatcggaacggtgttggagaagcagaaacagataatgcctgcgctgcaagcatat
agcaaggcggtagaactcgcgccgcgagctgcgcagacccggtacaagaaggctcgagca
ttgctcgctgtaggacaactggacgctgcacagaaggagttgatggtgctgaaagacttg
gcaccggatgaggcgactgttcactttcttctcggcaaactgtataggagcatgggcgag
aagcaactctcagtgcggcactttaccattgctcttgctttggaccccaaggcaagccaa
caaattaaagaagcgattgagagttttgaagatgatgtggacatggacgactccatgatg
gcatga

DBGET integrated database retrieval system