KEGG   Nectria haematococca: NECHADRAFT_47179Help
Entry
NECHADRAFT_47179  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
nhe  Nectria haematococca
Pathway
nhe00600  Sphingolipid metabolism
nhe01100  Metabolic pathways
Module
nhe_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NECHADRAFT_47179
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     NECHADRAFT_47179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 9665534
NCBI-ProteinID: XP_003048952
JGI: 47179
UniProt: C7YYR7
Position
8
AA seq 461 aa AA seqDB search
MSGSEPFPLLNTANDQLHQRRFAPSSSVSNTTATEASISDARRRRKSSALGGDIRGDTGA
PALATSRASLDALQSGHKRLSKRRRARGLLARARQTMIKHTFVLPAVLTLCFLAGYAINP
TESNPIHHFIFLSYKLPQDDPNEPAQYGKGRWDIAFVAFYTIVLSFTREFIMQELLSPLA
RWYNLSRGKKARFMEQVYTAIYFGVLGPFGLWVMSHTPVWYFNTRGMYEGFPHQTHLAPV
KFYYLFEAAYWAQQAIVLVLGMEKPRKDFKELVGHHIVTLGLIGLSYRFHFTYIGLAVYV
THDISDFFLATSKTLNYIDSPLVGPYFGVFMVAWIYLRHYLNLKIIWSLLTEFETIGPFE
LNWETQQYKCRLSQVITTALLSSLQALNLFWLFCIVRIAWRFVVQNQLEDDRSEDEGEGE
DDEEDVPAPAPKANGHANGHANGHANGHANGNAVSNGNAKH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggctcagagccctttcccctgctaaacacagcaaacgaccagctgcaccagcgt
cgcttcgcacccagcagctccgtcagcaacaccacagccactgaagcatccatcagcgac
gcgcggaggcggcgcaagagcagtgccctcggaggcgacatccgcggcgacacgggtgcc
ccggcattggccacgagtcgtgccagtctcgatgcccttcagtccggccataagcgactt
tccaagcgccgacgtgctcgcggcctccttgctcgagctcgccagaccatgatcaagcac
accttcgtcctcccggctgttctcaccctgtgcttcctcgccggatacgccatcaaccct
accgagtccaaccctatccaccacttcatcttcctctcgtacaagctgcctcaggacgat
cccaacgagcccgctcagtatggaaagggtcgctgggatatcgcttttgtcgccttctat
accattgtcctgtctttcactcgcgagttcatcatgcaggagctcctttcaccgctcgct
cgctggtataacctcagccgtggcaagaaggcccgtttcatggagcaggtgtacacggcc
atctactttggtgtcctgggtccctttggtctctgggtcatgagccatactcccgtgtgg
tatttcaacacccgcggcatgtatgaggggttcccccaccagactcatctcgctcctgtc
aagttctactatctctttgaggctgcctactgggctcagcaggccattgtcctcgtcctg
ggtatggagaagcctcgcaaggatttcaaggagcttgtcggtcaccacattgtcactctg
ggactcatcggtctcagctaccgcttccactttacttacattggcctggccgtctatgtc
acccacgacattagcgacttcttcctggccacttccaagacgctcaactacatcgactct
cccttggtgggcccttactttggtgtctttatggtggcttggatctacctccgccactac
ctcaacctcaagatcatctggtctctgctgaccgagttcgagactatcggtccctttgag
ctgaactgggagacgcagcagtacaagtgccgcctgagccaggtcattaccactgctctg
ctctcttccctccaggccctgaacctcttctggctgttctgcatcgttcgcattgcctgg
cgctttgtcgtccagaaccagctcgaggatgaccgatccgaggatgagggtgagggtgaa
gatgatgaggaagatgtgcctgccccggcccccaaggccaacggtcatgcgaatggccac
gccaacggccatgctaacggtcatgccaacggcaacgctgtttcgaacggcaacgcaaag
cactag

DBGET integrated database retrieval system