KEGG   Nectria haematococca: NECHADRAFT_49419Help
Entry
NECHADRAFT_49419  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_49419
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NECHADRAFT_49419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 621 aa AA seqDB search
MALQTTVANVSSVALRICAVVFFRLAHFPSIAFALFAIYVPSYIATYFSKPQVEVLKDEV
DVTVKESAITSTTPLLTRNGVAVAPEPEVVTDVVDIKEKIVVGEKIPSAFKILLLGAPSA
RRPIASFLTFLINVIFIALTADALFRARWYYPADDLSFVRLGYVSPSEARFIIREPDQTK
LPITFEYHIQDPQLSAETNLWLTAGFVTSTTNSTDFTTTLTVPLDDSKQRKYEWRTSNNH
TGEFRSAPKPGQMPDTENGLFTFLSTSCILPRFPYNPVDHPLAIPGLRNLAEKLPSLSPQ
FMLFLGDFIYVDVPERFGKTVEEYRMQYRQVYASPDWAPVAQNLSWIHVLDDHEISNDWS
SNTTGIYSAAVDPWHIYQANVNPPKAQSATQSGPRSNATWYEFTQGPASFFMMDTRSYRS
SNNLPFNATDKTMLGREQLADLLSWLARPEPQGVRWKFIASSVPFTKNWPVNVKDTWGGF
LTERKLILEAMWDSGARGTGVVILSGDRHEFAATRFPPPVGSRWPQSAAAHEFSTSPLNQ
FAAPFPTYKQTDDEDVMMNYIPGGISKFGSFSIDKQGEKSSLNYTLYIDGKETWTTLVEA
PEAPEGFKSPPSIWDRLHQFF
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccctccagacgacagtcgcaaacgtatcctcggtcgccctgaggatatgtgccgtt
gtctttttcagacttgctcatttcccttcaattgcatttgcactcttcgccatctatgtt
ccctcttacatcgcgacctacttctccaaaccccaagtggaggtcctcaaggatgaagtc
gacgtcacagtgaaagagtccgccattacatctacaacaccgttgttgaccagaaacggt
gtcgcagtcgcccccgagcctgaagttgttaccgatgtggttgacatcaaggagaagatt
gtcgttggtgaaaagattcctagcgctttcaagatcctcttgctgggagctcccagcgcc
agacgccccattgcctcattcctgaccttccttatcaacgtcatcttcatcgccttgaca
gccgacgctttgttccgtgcgagatggtactaccctgccgatgacctctccttcgttcgt
cttggatacgtctccccatctgaggctcgcttcatcatccgtgaacctgatcagacaaag
ctgcccatcacattcgaataccacattcaggatccccaactatcagctgagaccaacttg
tggttgactgcaggctttgtcacctcgaccactaacagcaccgacttcacaacaactctg
actgtgccccttgacgactcaaagcagagaaagtatgagtggagaacctccaacaaccac
actggcgagttccgatctgcccctaagccaggacagatgcccgacaccgagaatggattg
ttcacgttcctctctacttcttgcatcttgcctcgattcccctacaacccggtggatcat
cccttggctatccctggtttgagaaacttggcagagaagcttccctcgctgagccctcag
tttatgctattcctgggcgactttatctatgttgatgttcccgagcgatttggaaagact
gttgaggagtaccgcatgcagtaccgtcaggtttacgcttcaccagactgggctcccgtg
gcccagaacctgagctggattcacgtccttgatgaccacgaaatttcgaatgactggtct
tcaaacacgactggcatttacagcgccgccgttgatccctggcacatctatcaagccaac
gtcaacccacccaaagcccagtctgccacacagagtggcccaaggagtaacgctacttgg
tacgagttcacccagggccccgccagcttcttcatgatggacacccgcagctaccgctcc
agcaacaacctccctttcaatgcgaccgacaagaccatgcttggaagggagcagctggct
gacttgctgtcttggttggcccgtcctgagccccagggagttcgatggaagttcattgct
tcgtccgtcccctttaccaagaactggcctgtcaatgtcaaggatacctggggcggtttc
cttacggagcgaaagctgatccttgaggccatgtgggattccggtgcacgaggcacaggc
gtcgttattctgtccggtgatcgacacgagtttgctgccaccaggttccctccacctgtc
ggttcgcgatggcctcagtctgctgccgctcacgagttttccaccagccctctgaaccaa
ttcgctgctcctttcccgacatataagcagacagatgatgaagatgttatgatgaactat
atccccggtggcatctccaagtttggttccttctcgatcgacaagcagggagagaagagc
agcctcaactacacactctacattgatggcaaggagacttggacaacactggtcgaggcc
ccggaggccccggagggcttcaagtctcctccctcgatctgggaccggcttcaccagttt
ttttag

DBGET integrated database retrieval system