KEGG   Nectria haematococca: NECHADRAFT_50509Help
Entry
NECHADRAFT_50509  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nhe  Nectria haematococca
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_50509
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NECHADRAFT_50509
   00603 Glycosphingolipid biosynthesis - globo series
    NECHADRAFT_50509
   00604 Glycosphingolipid biosynthesis - ganglio series
    NECHADRAFT_50509
   00511 Other glycan degradation
    NECHADRAFT_50509
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NECHADRAFT_50509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 547 aa AA seqDB search
MNRILSLTQYQLDAARQYYPLSFIVELCSYISFFKQNTLHLHLSDNLWNNPELFDFEEQM
RLYATFRLYSDDPQVKGLNKRPDESYTREVFDDIQSKCVAHEVTILPKIEAPGHALVFSQ
WKPQIGMSSDHTLLNITHPETIPAVKTVWKVFMPWFHSKTVSIGAHEYRDSSLDENALTA
EYERFVNELNYFITQESGKKVRIWGTFPPSSGSNVDKSVSIQHWANFEAHAVTDWLANDY
NVLNSGDDLYVVSKWSSGYPQVLNQTFIFHGSPDGSAFAPSIFDPVNETENTSGDDPRIE
GHIAPLWTDWGPNSTTILETYYSWRDGLPALADKQWGGNLTEEEYPSLFEALQPFVPGQN
LDRWIPSKGSTILEYDFTHNSHQSIVKDKSGNSYDAKSSCKLSKRGILLLPSCKVTIPLS
SKGRDYTFSFSINPTSKKPEPIFTGPDSSLWAGHGSTTNVTLVADDSAYTLNYTFPLNKW
TNAKLIGKGPRAFMAVNGQEPMEFLTKIGIRGRRYVWGKIAVEASLSVIGGGDFEGILSY
VKLKDNA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatcctctcactgacacaatatcagctcgacgctgctcgacagtactatcct
ctcagcttcatcgtggagctctgctcatacatatcattcttcaaacaaaacaccctccat
ctccatctcagcgataacctctggaacaacccagagctgtttgactttgaagaacagatg
aggctgtacgccactttccgactgtactctgacgacccgcaagtcaaaggtctaaacaag
agaccggacgagtcttatacccgcgaggtctttgacgacattcaatccaagtgcgttgcc
catgaagtcactatcctgcccaagatcgaggcccccggtcatgctttggtcttttcacaa
tggaaacctcagattggcatgtcttctgaccacacgctgctcaacatcactcatccggaa
accatccccgccgtcaagacggtgtggaaggtgtttatgccgtggttccacagcaagact
gtctccatcggtgcacacgaatacagggatagtagcctcgacgaaaatgctctgacagct
gagtatgaacgattcgtaaacgagctgaactacttcatcacacaagaatccgggaagaaa
gtccgcatctggggaacctttccgccatcctcgggcagcaacgtagacaagtcagtctcg
attcaacactgggccaacttcgaagcacacgccgttacagactggctcgccaacgactac
aacgtcttgaactcaggagatgacctgtacgttgtatcgaaatggtcaagcggttacccc
caggtcttgaatcagaccttcatattccatgggtcccctgatgggagtgcttttgcgcca
agcatttttgatcctgtcaacgagaccgagaatacgtctggcgatgatccgagaatcgaa
ggtcacatcgctccgttgtggactgactggggccccaactcgactaccatcttggagacg
tattacagttggcgggatggccttccggctcttgctgacaagcaatggggtggcaatttg
acagaggaagaatatccgtcgctctttgaagcccttcaaccttttgttcctggccaaaat
ctggatcgctggattccgtccaagggctccacgattctagagtatgactttacccacaac
tctcaccagagtatagtcaaggataagtctggtaacagctacgatgccaaatcgtcctgt
aaactttccaagagaggtatccttcttttaccctcttgcaaagtgacaattcctctatca
tccaaaggacgagactacaccttttcattctccatcaatccaacctccaaaaagcctgag
ccaatctttacaggccccgacagctcactctgggctgggcacggaagcaccaccaacgta
accctcgtggcagacgactcagcttacaccctaaactacacctttcccctgaacaagtgg
acgaatgctaagttgataggaaaaggacctagggccttcatggctgttaacggccaggaa
cccatggagtttctcaccaagattggcatccgcggtaggcgatatgtgtgggggaagatt
gcagttgaagcttcgttgagcgtgattggcggaggagactttgagggcatcctgagctat
gtcaaattaaaagataatgcgtga

DBGET integrated database retrieval system