KEGG   Nectria haematococca: NECHADRAFT_50653Help
Entry
NECHADRAFT_50653  CDS       T01612                                 

Gene name
HAG2103
Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 567 aa AA seqDB search
MTVTAVHTKKKPDLAPESERFLRCCADVANALIEDHEASKAGRTTRDINLNSLRNKLAKK
HKLMNIPPLTAIIASIPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHRCPHIAYTGNI
CVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKSLGHSVDKVEYI
IMGGTFMSLPESYRNEFIAQLHNALSGYQTTNVDEAVEAGEMSNIKCVGITIETRPDYCL
QPHLSDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGYKVVSHMMPD
LPNVGMERDIDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNGLIDL
VARILALIPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGV
NEIKNKIRPNQIELVRRDYVANGGWETFLAYEDPKQDILVALLRLRKCTEKYTYREELIG
QPTSMVRELHVYGTAVPVHARDPRKFQHQGFGTLLMEEAERIAREEHGSDKISVISGVGV
RSYYKKLGFWLDGPYMSKWLDGREGPQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgactgcggtccacaccaagaagaagcccgacctggcaccagagagcgagcgc
ttcctgcgatgttgcgccgacgtcgccaacgccctcatcgaagaccatgaagcctccaag
gctggtcgcaccactcgcgacatcaacctcaactctctgcgcaacaagctagccaagaag
cacaagctcatgaacattccgcccttgaccgccatcatcgcctctattcccgagcattac
aagaagtatatcctgccaaagctcatcgcgaagcctattcggacgtcttctggaattgcc
gtcgttgctgtcatgtgcaagcctcatcgatgccctcatatcgcttataccggcaacatc
tgcgtctactgccctggtgggccagactccgatttcgaatacagtacacagtcatatact
ggatacgagccgacttcaatgcgagccattcgtgcgcgatacgacccctttgagcaggcg
cgaggacgagtcgaccagctcaagtctcttggtcactctgttgacaaggtcgaatatatc
atcatgggaggcacctttatgtcattgcccgagtcataccgaaatgagtttattgcgcag
cttcacaatgcgctgagcggataccaaacaaccaatgtggatgaagctgtggaggctggc
gagatgagcaacatcaagtgtgtcggtattacaattgagacacgacccgactattgtcta
cagcctcacctttccgatatgctgcgatatggctgcacaagattggaggttggagttcag
tcgctttacgaagatgtggcacgagacacaaaccgaggacacacagtagctgctgtcgca
gagacattctgccttgccaaggatgctggatacaaggtcgtcagccacatgatgcctgac
ttgcctaacgtgggcatggagcgagacattgaccaattccgagagtatttcgagaaccct
gccttcagaacggacggtctcaagatctacccgacccttgtcatccgaggcacaggcctt
tacgagttgtggcggacggggcggtaccagaactacacaccaaatggcctgatcgatctg
gtggctcggatcttggccttgatcccaccctggacgcgcatctaccgagtgcagcgagat
attcccatgcccctggtcacatctggagttgagaacggcaacttgcgtgagttggctttg
gctcggatgaaggactttggcacgacttgccgagatgtgcggacgagagaggttggtgtc
aatgagatcaagaacaagattcgacccaatcagattgaacttgttcgaagagactatgtc
gccaatggtggctgggagaccttccttgcctacgaggaccccaaacaggatatcctcgtt
gctctactacggttgcgaaagtgcacagaaaagtacacttacagggaggagctcatcggc
caacccaccagtatggtcagagagcttcacgtctacggcacagccgtccccgtgcacgcc
cgcgacccccgcaagttccagcaccagggtttcggtacactacttatggaagaggccgag
aggatcgcacgggaggagcacggcagcgacaagatcagcgtcatctctggtgtcggtgtg
aggagttactacaagaagctcggattctggcttgatgggccttatatgagcaagtggttg
gatggacgggagggtcctcagtga

DBGET integrated database retrieval system