KEGG   Nectria haematococca: NECHADRAFT_50873Help
Entry
NECHADRAFT_50873  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nhe  Nectria haematococca
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nhe00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 458 aa AA seqDB search
MASGPEFTAKEVAAHNTSDDCWMTIQGQVYDVTKYIHDHPGGADILIEAAGKDATVDFDN
AGHSEDAFEIMEEYCVGKYKGAPRKDAPKRVTLQPKATPKVKSGGRSSAVVATAATAAVS
SALALHQVYRFNPGALDVLPAFKLSSKPNRGLGFFEGFILASALFTVAGAYAVKRLSKFL
HFEEGGFMSYPPHKKIPKVSKPNPLIQRGWLDPSTYHALPLTEKELIAPNVYRLVFALPK
PTTLLGLPIGQHLSIKADVGGKSVNRSYTPISNNSDLGTLELVIKYYPEGQLTGGYLANV
EVGDEVLFRGPKGAMRYQHGLCKKIGMLAGGTGITPMFQIIRAICEDDQDLTEVSLIYAN
RSEEDILLRRELESFARRYPQNFKLYYLLDNAPAEWKYGTGYVTQELMAEKFPAPGPDSK
VMLCGPPGMISAAKKSLVNLGFEKPGASSKMTDQVFCF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaccggaatttactgccaaggaggtggcagctcacaacacttctgatgac
tgctggatgacaatccaagggcaagtctacgatgtcaccaaatacattcatgatcatcct
ggcggtgcagacattctcattgaggctgctggcaaagatgctacggtagactttgacaat
gctggccattctgaggatgcctttgagattatggaagagtattgcgttggaaagtacaag
ggagctccgagaaaagatgctcccaagcgtgttactcttcagcccaaagcaactcccaag
gtcaagtcaggaggccgatcttctgcagtcgtggctaccgccgccaccgctgccgtgtca
agtgcgctggctctacaccaggtttatcggtttaatcctggggccttggatgtacttcct
gctttcaagctttcgtcaaaacccaaccgaggcctgggattctttgaagggttcatcctg
gcgtctgctctgttcaccgtcgctggcgcttacgcggtgaagagactttccaagtttctc
catttcgaagaaggcggtttcatgagttatccccctcacaagaagatacccaaagtctcc
aaacctaatcctcttattcaacgaggatggcttgacccttcgacataccatgctcttcca
ctcaccgagaaggagctcattgcccccaatgtctaccgattggtttttgccctgcctaag
cccacaacattgcttggtctcccaatcggccaacatctttcaataaaggcggatgttgga
ggcaaatcggtcaaccggtcttacacacccatttccaacaactcggatctcggcactttg
gagttggtgatcaagtactatcccgagggacaactgacaggaggatacttggccaacgtt
gaagttggagatgaagtgctattccgaggacccaagggcgccatgcgatatcagcatggt
ctctgcaaaaagattggcatgttggctggtggaactggcattactcctatgttccagatc
atccgtgccatctgcgaagatgaccaagacctcacggaagtcagtttgatatacgccaac
agatcagaggaggatattcttctccggagagagcttgaatcattcgctcgtcgatatcct
cagaactttaaactatactacctcctcgacaatgccccagctgagtggaagtatggtacc
ggctacgtaacgcaggagctcatggctgaaaagtttcctgcacctggaccagactcaaag
gtcatgctgtgtggcccaccagggatgatcagcgcagccaagaagtcgctggtcaatctg
ggtttcgagaagccgggagcttcgtccaagatgacggatcaggtcttttgcttctga

DBGET integrated database retrieval system