KEGG   Nectria haematococca: NECHADRAFT_52485Help
Entry
NECHADRAFT_52485  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
nhe  Nectria haematococca
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NECHADRAFT_52485
   00500 Starch and sucrose metabolism
    NECHADRAFT_52485
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     NECHADRAFT_52485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11
AA seq 315 aa AA seqDB search
MFTSSLLLVSSLVAGAFAAARTEAPSGAIVVGEGGDFTSIQEAVNSVSGSDSVIFVKPGT
YEEQVLIPDSAGALTIYGYTEDDQDYSKNQVTLTHSLGADEAGNNDSSGTLRAKNNGLKV
YNINVANSRGQGVQAIALSAYGDEQGYYGCQFTGYQDTILTNKGKHYFHASYIEGATDFI
FGQESVAWFEQCDIGVVAKGYITANGRDSAENPSYYVINKSVVKAAGAGDGEVYLGRPWR
EFARVVFQNTELGSVINSAGWLAWGDNPTNNVEYGEFGNTGAGASGDRASFSKQLSAAVS
IDEILGSTSWIDSSY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctcttctctccttctcgtgtcatcgttggtggccggcgcttttgccgctgct
cgaactgaagcccctagcggtgccattgttgttggtgaaggtggcgatttcacctcgatt
caggaagccgtcaattccgtttctggctctgattctgtcattttcgtcaagcctggaacc
tacgaggagcaggttctcattcccgactctgctggagctcttaccatttacggatacacc
gaggatgaccaggattactccaagaaccaggtcactctcactcacagcctcggagctgac
gaggctggaaacaacgactcgtctggcactctccgggccaagaacaacggcctcaaggtg
tacaacatcaatgtcgccaactcgcgaggccagggtgtccaggccattgctctgagcgcc
tacggtgatgagcagggttactacggatgccagttcactggttaccaagacaccattttg
acaaacaagggcaagcactacttccacgctagctacattgagggtgccaccgactttatc
tttggccaagagtccgttgcttggttcgagcagtgcgacatcggtgttgttgcaaagggg
tacatcactgccaacggtcgtgacagtgccgagaacccttcgtactacgtcatcaacaag
tcagttgtcaaggctgccggtgccggagacggcgaggtctaccttggtcgcccgtggcga
gagtttgcccgcgttgtcttccagaacaccgaactcggcagcgttatcaactctgctggc
tggcttgcctggggtgacaaccccaccaacaacgtcgagtacggcgagtttggaaacact
ggcgccggtgctagcggtgaccgcgccagcttctccaagcagctgagcgctgctgtttcc
attgacgaaatccttggttctacctcttggattgactcgagctat

DBGET integrated database retrieval system