KEGG   Nectria haematococca: NECHADRAFT_57725Help
Entry
NECHADRAFT_57725  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
nhe  Nectria haematococca
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_57725
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     NECHADRAFT_57725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 281 aa AA seqDB search
MATLAAGGIGAGILAKLLFGNASAESDAPTKIFKGGPAFVSLPLESAELVNHNTKRLRFK
LPQEHAVSGLPLTSALLTLSWPKGQWVPVPRPYTPVSASDEPGYLELLVKKYPNGRASSH
LHSLNPGDKLLFAAAIKGYSWKPNSYSHITLIAGGAGITPIYQLAQGILKNPNDKTSMTL
VFGVNSDEDVLLKQEFEQFSKEYPDRFKAIYTVSHPKDGSPFRKGYVTKELLKEIVPSPT
QQETKVFVCGPPAMEDSLVGKWNSPGILSQVGFRKDQIHKF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccactctggccgcgggtggcattggggctggaatccttgccaaactcttgtttggg
aatgcttccgctgaatctgatgctccgacaaagattttcaagggtggtcctgcttttgtt
tcgttgccgcttgagagtgctgagctggtcaatcacaacacgaagcgattgcgcttcaag
cttccccaggagcatgctgttagcggacttcctttaacttctgccttgttgacgctatcg
tggcccaaaggacaatgggtgcccgttcctcgaccctacaccccggtctctgcctcagat
gagcctggatacctagaacttctagtaaagaagtaccccaatggcagggccagcagccac
cttcactccctcaacccaggagacaagctactctttgccgctgccatcaagggttacagc
tggaagcccaacagctactcccacatcaccctcatcgccggtggtgctggaatcacaccg
atctaccaactggcgcaaggaattctgaagaaccctaacgacaaaacttcgatgacgctg
gtgtttggtgtcaacagcgacgaggacgttctactcaagcaagagtttgagcagttctcg
aaggaatatcctgatcggttcaaggccatctacactgttagccaccccaaggatggatca
cccttccgaaaaggctatgtgacgaaggagcttctcaaggagattgtgccttcgcctacg
caacaggagaccaaggtctttgtttgtggtcccccagctatggaggactctcttgttggg
aaatggaactcgcctggaatcttgagccaagtgggtttcagaaaagaccaaattcacaaa
ttttaa

DBGET integrated database retrieval system