KEGG   Nectria haematococca: NECHADRAFT_58049Help
Entry
NECHADRAFT_58049  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nhe  Nectria haematococca
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nhe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nhe01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 475 aa AA seqDB search
MSSSTAAGKQAQAFPDGTKDYIPLRSGAPKSNANKVHISDVPMTWKNIHQHINWLNTTLV
VIVPMIGFISAYWVPLQLKTALWAVFYYVHTGLGITAGYHRLWSHSAYKGTLPLKIYLAA
VGAGAVQGSIRWWSYGHRVHHRYTDTDKDPYSVRKGLLYSHMGWMVFKQNPKRQGRTDIT
DLNEDAVVVWQHKNYIKCVLFMALGFPMLVAGLGWGDWWGGLVYAGILRVCFVQQATFCV
NSLAHWLGEQPFDDRNSPRDHVITAIVTLGEGYHNFHHEFPSDYRNAIEWWQYDPTKWSI
WMWKQLGLAYELKQFRQNEIEKGRVQQLQKKLDQKRATLDWGIPLDQLPVVDWDDFVADS
KNGKGLVAIAGVIHDVTDFIKDHPGGRALINSAIGKDATAIFNGGVYNHSNAAHNLLSTM
RVGVLRGGCEVEVWKRAQFENKDVTYMNDSAGARIIRAGNQVTKVIQPAASADAA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtccaccgccgcgggcaagcaggcccaggccttccctgatggcaccaaggac
tacattcctcttcgatccggtgcccccaagagcaacgccaacaaggtccacatctccgac
gtccccatgacctggaagaacattcaccagcacatcaactggctcaacaccactctcgtt
gtcatcgttcccatgattggcttcatctcggcctactgggttcctcttcaactcaagacc
gccctctgggctgtcttctactacgttcacactggtctcggtattactgctggttaccac
cgtctgtggtctcactccgcttacaagggcactcttcccctcaagatctacctcgctgcc
gtcggcgctggcgccgtccagggctccatccgatggtggtcgtatggtcaccgcgtgcac
caccgctacaccgataccgacaaggacccctactctgtccgcaagggtctcctctactcc
cacatgggctggatggtcttcaagcagaaccctaagcgtcagggccgaaccgacattacc
gatctcaacgaggacgccgtcgtcgtctggcagcacaagaactacatcaagtgcgtcctc
ttcatggctctcggtttccccatgctcgttgccggtctcggctggggtgactggtggggt
ggcctcgtctatgctggtatcctccgtgtctgcttcgtccagcaggctaccttctgcgtc
aactctctcgcccactggctcggtgagcagccctttgacgaccgcaactctcctcgtgac
cacgtcatcaccgccatcgtcactctcggtgagggataccacaacttccaccacgagttc
ccctcggactaccgcaacgccattgagtggtggcagtacgaccctaccaagtggagcatc
tggatgtggaagcagctcggccttgcctatgagctgaagcagttccgccagaacgagatt
gagaagggccgtgtccagcagctccagaagaagcttgaccagaagcgtgccaccctcgac
tggggtattccccttgaccagctccctgttgtcgactgggacgacttcgtcgccgactcc
aagaacggaaagggtctcgtcgccatcgccggtgtcatccacgatgttaccgacttcatc
aaggaccaccccggtggccgcgctctcatcaactcggccattggcaaggatgccaccgcc
atcttcaacggtggtgtctacaaccactccaacgccgcccacaaccttctgtccaccatg
cgtgttggtgttctccgcggtggttgcgaggttgaggtctggaagcgtgctcagttcgag
aacaaggatgtcacctacatgaacgactctgctggcgctcgcatcatccgagccggcaac
caggtcaccaaggttatccagcctgcggccagcgccgacgctgcctaa

DBGET integrated database retrieval system