KEGG   Nectria haematococca: NECHADRAFT_58461Help
Entry
NECHADRAFT_58461  CDS       T01612                                 

Gene name
pfk1
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nhe  Nectria haematococca
Pathway
nhe00010  Glycolysis / Gluconeogenesis
nhe00030  Pentose phosphate pathway
nhe00051  Fructose and mannose metabolism
nhe00052  Galactose metabolism
nhe00680  Methane metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
nhe01230  Biosynthesis of amino acids
nhe03018  RNA degradation
Module
nhe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECHADRAFT_58461 (pfk1)
   00030 Pentose phosphate pathway
    NECHADRAFT_58461 (pfk1)
   00051 Fructose and mannose metabolism
    NECHADRAFT_58461 (pfk1)
   00052 Galactose metabolism
    NECHADRAFT_58461 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    NECHADRAFT_58461 (pfk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NECHADRAFT_58461 (pfk1)
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NECHADRAFT_58461 (pfk1)
Protein phosphatases and associated proteins [BR:nhe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NECHADRAFT_58461 (pfk1)
Messenger RNA biogenesis [BR:nhe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NECHADRAFT_58461 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK UVR
Motif
Other DBs
NCBI-GeneID: 9678551
NCBI-ProteinID: XP_003046746
JGI: 58461
UniProt: C7Z538
Position
2
AA seq 783 aa AA seqDB search
MAPKKKIAVMTSGGDSPGMNAAVRAVVRMTLHMNCDAFCVYEGYEGLVQGGDFIRQMQWN
DVRGWLSEGGTLIGTARCMAFYERPGRLTAAKNMVLAGIDALIICGGDGSLTGADKFRAE
WPSLLEELVQDGQLTASQIEPYQHLNIVGLVGSIDNDLTGTDATIGCYSALSRICEMVDY
IEATASSHSRAFVIEVMGRHCGWLALMAGVATGADFVFIPERPREHDWQGEMKMVVQRHR
SLGKRKTIVIVAEGARDKNGTKITAEEIKDLLADKGEGGLALDTRITTLGHVQRGGTAVA
YDRMLATLQGVEAVKAVLDATPETETPFIAINENKIVRKPLMKAVAETKELAKAVDAKDF
EKAMSLRDAEFYDQWNSYMLTTNVMVDDQKLPEKDRMRIGFINVGAPAGGMNAAVRAAVA
YCISRGHEPMAIHNGFAGFSRHHGDKPFGSVRPFDWLEVDGWASKGGSEIGTNRELPNES
GMERIANLIEEYHFDALFIVGGFEAFHSISQMRKARDTYPSLCIPMTLLPATISNNVPGT
EYSLGSDTCLNELVNYCDKIKQSASATRRRVFVIETQGGRSGYIATLSGLDVGASAVYIP
EEGVSLEMLNSDVNHLKEVFKKDKGQSRAGRLILVNEKASKVYNAKLIADIIREEAHDRF
ESRESIPGHVQQGGVPSPMDRCRAVRLAIKCIQHIEGFGRNAHNHVKKDPRSTTVIGIQG
SEVVFTEMKELEETGTDWPNRRPKIAHWIGLSEVVNMLAGRPEYPSPEKSLTGLIAKDTK
RGL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaaaagaagattgctgtcatgacctcgggaggtgactctcccggcatgaac
gctgccgtccgcgccgtcgtgcgcatgacgcttcacatgaactgcgatgccttctgtgtc
tatgagggatacgaaggcctggtgcagggcggcgactttatccggcagatgcagtggaac
gacgttcgaggctggctctctgagggtggtactctgatcggtactgcccggtgtatggct
ttctacgagcgtcccggtcgtttgacggccgccaagaacatggttcttgctggcattgac
gctctgatcatctgcggaggtgacggctccctaactggtgccgacaagttccgcgccgag
tggccttctctgctggaggagcttgtccaggatggccagttgacggccagccagatcgag
ccataccagcacctgaacattgttggtcttgtcggctccatcgacaatgatctcactgga
actgatgctacaattggctgctactcggctctctcacgcatctgcgagatggttgactac
atcgaagccacagcttcctcgcattcgcgcgcctttgttatcgaggtcatgggacggcat
tgcggttggctggccctcatggccggtgtcgcaactggcgctgattttgtttttatcccc
gagagacctagagagcatgactggcagggggagatgaagatggtggttcaaaggcaccgg
agcctcggaaagcgcaagacgattgtcattgtcgccgagggtgctcgcgacaagaatggc
accaaaatcactgccgaggaaatcaaggaccttctcgccgacaagggcgagggtggtctt
gctcttgatacccgtatcacaactcttggtcatgtccagcgaggtggaactgctgtcgcc
tatgatcgaatgttggctaccctacagggtgtcgaggccgtcaaggcggttctcgatgcg
acccccgagacggagacgcccttcatcgctatcaacgaaaacaagattgtccgcaagcct
ttgatgaaggctgttgctgagaccaaggagcttgccaaggctgtcgacgccaaggacttt
gagaaggccatgtctcttcgagatgccgaattctacgatcagtggaactcttacatgcta
accaccaacgtcatggtggacgaccagaagctgcctgagaaggaccgcatgagaattggc
ttcatcaacgtcggtgcccctgctggtggcatgaatgctgccgtgcgtgccgctgttgca
tactgtatctcccgaggccatgagcccatggccattcacaacggtttcgccggcttttcc
aggcatcacggcgacaagccctttggatccgttcgtccctttgactggctcgaggttgac
ggctgggccagcaagggtggttccgagattggcaccaaccgagagcttcccaatgagtct
ggcatggagcggattgccaacctgatcgaggagtaccacttcgatgccttgttcatcgtc
ggcggtttcgaggccttccactccatctctcagatgcgcaaggccagagacacgtacccc
tcgctctgcatccccatgactctgcttcccgccacaatctccaacaacgttcctggaaca
gagtactcgcttggctctgacacttgcctcaatgagctcgtcaactactgcgacaagatt
aagcagtcagcttctgccactcgtcgccgtgtgtttgtcatcgagactcagggaggtcgc
tctggttacattgctaccctgagtggtctggatgttggtgcttccgccgtttacatcccc
gaggagggtgtcagtctcgagatgctcaactcggatgtcaaccacctcaaggaagtgttc
aagaaggacaagggccagtcccgcgctggtcgtctgatcctggttaacgagaaggccagc
aaggtctacaacgccaagctcattgcagacattatccgcgaggaggctcatgaccgattt
gaaagtcgagagagcatccccggtcacgtccagcagggtggtgttccctcgcccatggac
cgctgccgagccgtccgtctggctatcaagtgcatccagcacatcgaaggctttggccgc
aacgctcacaaccacgttaagaaggatcctcggagcacgactgtgatcggtatccaaggg
tcggaggttgtgtttaccgagatgaaggagctggaggagactggcaccgactggccgaac
cgaagacccaagattgcccactggataggactatccgaggtggttaacatgctggcgggc
cggcccgagtatcctagcccggagaagagtctgacagggctgatcgccaaggacacgaag
cgtggcctgtag

DBGET integrated database retrieval system