KEGG   Nectria haematococca: NECHADRAFT_58970Help
Entry
NECHADRAFT_58970  CDS       T01612                                 

Definition
hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 885 aa AA seqDB search
MATLTESEIEKLFSGAPQYFARSEGHCSGAPNPSVAFPFDEALEIRDLTDHVQIEDRAWS
GLTAWPHLTRDLNHDAVAQKKAVESRKAHFFIRCRERPNMLSMQGLEKGTMGYSAALELA
VGDSLQEEQWGFDSVGKKAQAIVEARERMLSPLGYLRRLPESEILDRIKRNGELYRVNDL
RKKTTVQTYQDLFHTFMRPVNSVVDKRDHYSLTNQINALLKCLGTANVWFDFTHVEWRIR
LGQILWGGADNDDLDDASSIHDATSASERAEEKYWLLMQILVATELLIRLDAITEGEEYG
VEAFRPIDVVHFERAATPMVKWSLHLARSWLENVEIEKAEDSTPKGTVTPPGSSSGWLGS
LVSKFTFRQRQEEATPTSNYSYTIKGRHSQQQVEGLTHFAKKIHWPGIDTYEGLIAKSAR
QSMGIAPSPALVKTPKENGSKRASYFGAWDRPAGEKNVNKPQPQRRKLAAALHSSGWLSK
SYIFGLMLPGEGVYHFLMATLLENDKNAMAKLGPFANLCGGFVYSGKSFWSTSCIVGRVI
AAGKGSAECMGWVSSDILPLGLDEGWVNIEVEDVAEDNAHLGKKARLWAKKRVERESSIL
GDADEYSVLPADFIIPHENNYSTPPPLMSVTLRSLELLAPANSIQATPFAKSASLAGSNT
KDPELLSFPANINFGVSIDGFTPENFSFSLSYDISFVTAHPCSPSHRVRFLKSPSSPTIQ
QIDVSGSDMLGKSSRPAHRTGHPLHKWYNYTVMHISELLKRQQAPLSELLAVPQTHRRSP
SRMGSERVLVIDCITNLAEVPQSPTIERLTSKYNIVQRRGSFPAAEQMHFESRKRQFGSD
MEILVRALCAQKGWNAIISRRKRGCLACAIREAGALQWKVIIRVE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggccactcttaccgagtctgagattgagaagctcttctcgggcgcaccccagtacttt
gcccgcagcgagggtcattgctctggcgcacccaatcccagtgtcgcctttccctttgac
gaagcattggagatccgcgacttgaccgaccacgtccagatcgaggacagggcctggagc
ggtctcactgcatggcctcatctcacccgcgatctcaatcatgatgccgtcgcccagaag
aaggccgtcgagtcccgcaaggcccacttcttcatccgctgccgggaacgccccaatatg
ctaagcatgcagggcctcgagaagggaaccatgggttactcggctgcccttgagctcgct
gtcggtgattctctccaggaagagcaatggggttttgacagcgtcggcaaaaaggctcag
gccattgtcgaggcacgcgagcgtatgctttccccgctggggtacttgcgccgcctcccc
gagtcagagatcctcgaccgcatcaagcgcaatggcgagttgtatcgcgtcaatgatctc
cgcaagaagacgactgtccaaacgtaccaggacctatttcacacttttatgcgtcctgtc
aattctgtcgtcgacaagcgcgaccattacagtctgaccaaccagatcaatgccctcctc
aagtgtctgggtactgccaatgtctggtttgactttacccatgttgagtggaggatcagg
ttaggtcagatcctctggggaggtgccgacaacgatgaccttgacgatgcctcctccatt
cacgatgctactagtgctagtgagcgtgctgaggagaaatactggcttctcatgcagatt
ctcgttgctaccgaattgctcatccgattagacgccatcaccgagggcgaggagtatggc
gtcgaagctttccgccccattgacgtcgttcactttgaaagggctgccacccccatggtc
aagtggtcgttgcatcttgcccgaagctggcttgagaatgtcgagattgaaaaggccgag
gattctaccccaaagggaaccgttacccctcccggatcatcgtcaggctggcttggatcg
ttggtcagcaagttcaccttccgccaacgccaggaggaggccacgcccacctcaaactat
agttataccattaagggccgtcactcacagcaacaagtcgagggtctcacccatttcgca
aagaagatccactggcccggcatcgatacctacgaaggcctcattgcgaagagcgcccgt
cagtcaatgggcattgcgccatctcctgcgcttgtcaagactcccaaggaaaatggctct
aagcgagcatcgtacttcggggcatgggaccgaccggctggcgagaagaacgtcaacaag
ccccagcctcagcgacgaaagctcgctgctgctctacactcctcgggatggctttccaaa
tcatacatctttggattgatgcttccaggtgagggcgtgtatcatttcttgatggctacc
ctcctcgagaatgataagaatgccatggcaaagctgggcccgtttgccaatctgtgtggc
ggctttgtgtactctggcaagagtttctggagcacgtcttgcattgttggccgagttatt
gcagctggcaagggatcagccgagtgcatgggatgggtctctagcgacattctgcccctt
ggtctcgatgagggctgggttaacattgaggtcgaagacgtagctgaggataatgctcac
cttggaaagaaggcaagactctgggcaaagaagcgagttgagcgagagtcttccatcctc
ggagatgccgacgaatactctgttctccctgccgactttatcatcccccacgaaaacaac
tattctactcctccgccgttgatgagtgttacgctgcgatccctggagctgctcgctccc
gccaactctatccaggctacgcctttcgccaagtcagcttctctcgcgggctccaacacc
aaggaccctgaacttctctcgttccccgccaacatcaactttggtgtttcgattgacgga
tttactcctgagaacttttcgttctcgctctcttacgatataagctttgtcaccgcgcat
ccatgctcgccatcgcatcgcgttcgcttcttaaagtctccatctagtccaacaattcag
caaattgatgtctctggttccgatatgctgggcaagagctctcgcccggcacacaggaca
ggacatcccttacacaagtggtataactacacggttatgcacatctcggaactcctgaag
agacagcaggctccgctctcggagctccttgctgttcctcagactcaccgtcgctcacct
tcgcgaatgggtagcgagcgtgttcttgtaatcgattgcatcaccaacctagccgaggtt
cctcagtctccgaccatagagagactcacttcaaagtacaacattgttcagcgacgaggc
agtttccctgccgcggagcagatgcactttgagtcacgaaagcgacagtttggctcggac
atggaaattttggtccgtgccctctgtgctcaaaaaggctggaatgccatcatcagccgg
cgcaagagaggatgtctggcctgcgcgattcgcgaggccggggcgttgcagtggaaggtc
atcatcagggtggagtag

DBGET integrated database retrieval system