KEGG   Nectria haematococca: NECHADRAFT_59012Help
Entry
NECHADRAFT_59012  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 393 aa AA seqDB search
MAATVAPSHAGGLPSSSGIPAPPHPHDAADASAGSQDVAGGVSPLPPTRKFQLRDFRRVR
TLGTGTFARVCLVRPAASAHIPLDHQLNPEVYALKILRKPEVIRLKQVDHVRHERAILAD
VAGHPFITQLIASFSDHDSLYMLLDYVPGGELFTYLRKLRRFDEPVARFYAAEIVLVLEY
LHEQQGGIAYRDLKPENLLLDQDGHIKLVDFGFAKRLGHREDNRPVETYTLCGTPEYLAP
EVIQNKGHTGAVDWWALGILIYEFLTGYPPFWHQNPIEIYKHLCRILEKPVVFPQDPPLS
EDAKDIIRAFCTVDRSRRLGNISGGAARVKAHPFFRETNWDDMLNRRHKGPIQPPVRYPG
DAQCFDVYPEDDGSREPYGGDMAAKYDPYFADF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaccgttgcgccttcgcatgccggcggcctgccgtcctcctcgggcatccct
gcgccgccgcatccccacgacgccgcagacgccagcgcggggtcccaagatgtcgccggc
ggcgtctctccactaccgccaacccgcaagttccaacttcgcgactttcgacgagtgcgc
acgttaggcacaggaacctttgcccgagtctgtcttgtccgtccagcagccagcgcccat
atacccctcgatcaccagctcaaccccgaagtctacgccctcaagatcctacggaaacct
gaagtcatccgccttaagcaggtcgatcatgtccgtcatgagcgcgccatcctcgccgac
gtcgcgggtcatcccttcatcacccagttgatcgcctccttctcagaccacgattccctc
tacatgctcctcgactacgttcccggcggcgagctatttacatacttgcgcaagttgcgc
cgcttcgacgaacccgtcgcccgcttctacgccgccgagatagtcctcgtactagagtat
ctccatgagcagcaaggcggtatcgcctaccgcgacctcaaaccggagaacctcctcctg
gatcaggatggccacatcaaactcgtcgatttcggctttgccaagcgcctcggtcaccgc
gaagacaatcggcccgtcgagacctacaccctctgcggaacccccgaatacctggccccc
gaggtcattcagaacaaaggtcacacaggcgcagttgactggtgggctctgggtattcta
atatacgagttcttaacgggataccctccattttggcatcagaaccccattgagatttac
aagcacctttgcagaatcttggaaaaacccgtcgtcttccctcaagacccgccactctcg
gaagacgccaaagacataatacgcgccttctgcaccgtcgatcgttcccgtcgtctcggt
aacatcagcggcggcgcagcccgcgtaaaggcgcaccccttcttccgcgagacgaactgg
gacgacatgcttaaccgccgccacaagggtccgatacaaccccccgtgcgctatcccggt
gacgcccagtgctttgacgtgtacccagaggacgacggctcgcgggagccctacggcggc
gacatggcggcaaagtacgacccatactttgccgacttttaa

DBGET integrated database retrieval system