KEGG   Nectria haematococca: NECHADRAFT_59628Help
Entry
NECHADRAFT_59628  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nhe  Nectria haematococca
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NECHADRAFT_59628
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NECHADRAFT_59628
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_59628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 515 aa AA seqDB search
MPLINGNSKGSFIGAIDQGTTSSRFLIFDTSGEVVATHQLEFKQIYPHPGWHEHDPEELI
SSVEKCIDGAVESFEAQGNSRDQIKAVGITNQRETTIVWDRTTGKALHNAIVWTDTRSQE
LVRRLKRRLGASELPSRCGLPLSTYPSVSKLLWLLENVPDVKDAYERGVLAFGTVDTWLT
YKLNGGTERDIYVSDPSNASRTMFMNLETLKYDEDVIDWFRLDPAKITLPRIVRSSDTKA
YGSLAGTCLKGTKITGCLGDQSAALVGQKGFTPGLAKNTYGTGCFLLYNVGSKPVLSTHG
LLSTVAFDFGEGNTMYALEGSIAVAGSSVKFLVDNFGFIQSSSKLSALAETVEDNGGCTF
VTAFSGLFAPYWIDDARGTIFGITAYTQRGHIARATLEATCFQTKAILDSMEKDSGHALT
ELAVDGGMCNSDLIMQTQSDLIGIPVNRPAMRETTALGAAIAAGFAVGIWKDFRDLENVN
TQGRTIFEPQIANEEAAARFETWEKAVQMAKGWAS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcatcaatggaaactccaaaggctcctttattggagccattgatcaaggcaca
accagctcacgcttcctcatctttgacactagtggcgaagttgttgcgacgcatcagctc
gagtttaagcagatctatcctcatcctggatggcatgagcatgacccagaagagctcata
agctctgtggaaaagtgcatcgatggagctgtcgagtcctttgaggctcaaggcaactca
cgcgaccagatcaaggccgtgggcatcacaaatcagagagagacaaccatcgtctgggac
agaacgacaggcaaggctctgcacaatgccatcgtctggaccgacactcgatctcaagag
cttgtccgaagattgaagcgtcgtctcggggccagcgagttgccctcgagatgcggcctt
cctctctccacatacccctctgtcagcaagctgctatggctgctcgagaatgttcctgat
gtcaaggatgcgtatgaacgcggggtgctcgctttcggtaccgtcgacacttggctgacg
tacaagttgaacggcggcacggagcgtgacatttacgtgtcggatccttcaaatgcgtca
cgtaccatgttcatgaacctcgagacgctcaagtacgacgaggacgtcattgactggttc
cgtcttgaccccgcaaagattaccctgccaaggatcgtgcgatcctcggacaccaaggct
tacggttccttggctggcacatgcttgaagggtaccaagatcactgggtgtctgggcgac
caatctgctgctctcgtcggccaaaagggtttcacccctggtctcgccaagaatacatac
gggactggctgctttctgctctacaacgtggggtctaaacccgtcttgtctacccacgga
cttctgagcaccgtcgcctttgactttggcgagggaaacaccatgtacgcgctcgagggc
agcatcgccgtggcgggctcaagcgtcaagttcctggtcgacaactttggcttcattcag
tcgtcgtccaagctgagcgccctggccgagactgtggaggacaacggtgggtgcacattc
gtcacggcctttagtggcctgtttgcgccgtactggattgacgatgcccgaggtaccatc
tttggcatcacggcgtacacgcagcgcggacacattgctcgcgccacgctcgaggccacg
tgcttccagacaaaggccatcctggactcgatggagaaggacagcggccacgccctgacg
gagctggccgtagatggtggcatgtgcaactcggatcttatcatgcagacgcagtctgat
cttattggaatccctgtcaatcgaccagccatgcgggaaacaacggctcttggcgccgcc
atcgcagccggtttcgcagtgggaatctggaaggacttccgtgacctcgagaatgtcaac
acgcagggccggaccatttttgagccccagatcgctaatgaagaagcggcagctcgtttc
gagacgtgggagaaggcggttcagatggccaaggggtgggcgagctaa

DBGET integrated database retrieval system