KEGG   Nectria haematococca: NECHADRAFT_59700Help
Entry
NECHADRAFT_59700  CDS       T01612                                 

Gene name
HTB2101
Definition
histone 2B
Orthology
K11252  
histone H2B
Organism
nhe  Nectria haematococca
Brite
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NECHADRAFT_59700 (HTB2101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 137 aa AA seqDB search
MPPKAADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRSKTRKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVASEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaggccgccgacaagaagcccgcctccaaggcccccgccactgcctccaag
gctcccgagaagaaggatgccggcaagaagaccgctgcttctggtgacaagaagaagcgc
tccaagacccgcaaggagacttactcttcttacatctacaaggtcctcaagcaggtccac
cccgacactggtatctccaaccgtgccatgtccatcctgaactctttcgtcaacgatatc
ttcgagcgcgttgcttctgaggcttccaagctggctgcctacaacaagaagtccaccatc
tcttcccgagagatccagacctctgtccgcctgatcctccccggtgagcttgccaagcac
gctgtctctgagggtaccaaggccgtcaccaagtactcctcctcgacgaaataa

DBGET integrated database retrieval system