KEGG   Nectria haematococca: NECHADRAFT_60475Help
Entry
NECHADRAFT_60475  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 681 aa AA seqDB search
MSTPSTATVGALPRFHDPHYPPSYTHSHTHHQGYQANPSASYRSVATSQTILPPPVSSVA
SPSHSTAAILPPPYQHSPLAYSSSGSNTLSLAHSSAAPAARAEQPSRKRRRSREPDWNNF
YKNGLPKEIIVIDDTPEPEANTGRKITNGTATGPTDSTSGRQVAKKRRRDDEPGTIQGAG
YHIKYLGSQNNTPLQTSTPTGSSISSSDRTNSAINTAPTSLSSNGQYDDVQVPLKRKRTR
QQVANEAKRRDIDGLGDPFFTYKPPPYPPKKAGEVNVQVIHDRQYNKNVKVDDDDGHYIV
VPDAELTDKYKIVRLLGQGTFGKVVEARDRRRNKAVAVKIIRSVQKYRDASRIELRVLAT
LKANDEENRNRCIHLRDCFDYRGHICIVMDLLDQSVFDFLKGNAFVPFPNSQIQSFARQL
FTSVAFLHDLNLIHTDLKPENILLCNHSYQTFTYNRKIPSSSTTINRQATQRRVLLDTEI
RLIDFGSATFQDEYHSSVVSTRHYRAPEIILGLGWSYPCDIWSIGCILVEFFTGDALFQT
HDNLEHLAMMEAVVGHRIDSHLVQAVNKMSTRSGGNAASKYFKRLKLDYPTPDTTRGSRR
FVKAMKHLTDIIPSNNAFLKNFVDLLKKIFVYDPAQRITAKQALNHPWLKEMAQPDDGTE
AAKIRLERIRMEQQGARHQYV
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactccctctacggccacggttggagcattaccacgattccacgatccgcactat
cccccctcgtacacccattcacacacgcatcaccaaggataccaggcaaatcctagcgcc
agctatcgttctgttgctacgagccagactattctccctcctccggtttcgtcggttgcc
tcgccctctcatagcactgcggccatactcccgccgccctatcagcactcgcctctcgcg
tactcgtcatccggatcgaatactctgagcctcgctcactcctcggccgctcctgccgct
cgcgcggagcagccttccaggaagcgtcgccgctctcgtgagcctgattggaacaacttt
tacaaaaatggcctccccaaggagatcattgtaattgacgacactcccgagcccgaggcc
aatacgggtcgaaaaatcacgaatggcactgccactggccctaccgacagcacttcgggc
cgtcaggtggccaagaagaggagacgtgatgatgagcctggcaccatccagggcgcgggc
taccacattaagtatctgggatcacaaaacaacactccgctgcagacatcaacgcccact
ggctcgtccatctccagcagtgaccgcaccaattctgctatcaacactgcacctacttcg
ctttcctccaacggccagtacgacgatgtccaggttccactcaagcggaagcggacccgg
caacaggtagccaacgaggccaagcgtcgcgatatcgacggcctgggtgatccctttttc
acctacaagcctcctccttacccacccaagaaggctggcgaggtcaacgttcaggttatc
catgaccgacaatacaacaagaacgtcaaggtcgacgatgacgatggccactacattgtt
gtgccagatgctgaactgacagacaagtacaaaatcgtccgccttctgggccagggcact
tttggcaaggttgtcgaggcccgcgaccgaagacgcaacaaggctgttgccgtcaagatt
atccgatcagtgcagaagtatcgggatgcatcaaggattgaactccgtgtcctagccact
ctcaaggccaacgacgaggagaaccggaatcgatgcattcatcttcgggattgtttcgac
taccgcggccacatctgcatcgtcatggacttgctcgatcagagcgtgtttgatttcctc
aagggcaacgctttcgttcctttccctaacagccaaattcagagctttgcccgacaactc
tttacaagtgttgctttcctacacgacctcaacctgattcacaccgatctcaagcccgag
aacatcttgctctgcaaccattcataccagacctttacctacaaccgcaagattccctcg
tcttccacgactatcaacagacaggctactcaacgccgtgttctgctggacactgagatt
cggttgatcgactttggctccgcgaccttccaggatgaatatcattcgtcagttgtttcg
actcgccactacagagccccagagatcattctgggtctcggatggtcgtatccctgcgat
atttggagtatcggatgcatcctcgtcgagttcttcactggcgatgctctgttccagacc
cacgacaatcttgagcacctggccatgatggaagcagttgtgggacaccgcatcgacagc
cacctggtccaggccgtcaacaagatgtccacgcggagtggaggaaatgccgcttccaag
tacttcaagcggcttaagcttgattaccccacccctgacacgacccgcggctcccgacgc
ttcgtcaaggccatgaagcacctcacggacatcatccctagcaacaacgcattcctcaag
aacttcgtcgatctactcaagaagatattcgtctacgaccctgcccaacgtatcactgct
aagcaggccctgaaccacccctggctcaaggagatggctcagcctgacgacggcaccgag
gcggctaagatccgcctggagcggatacgaatggagcagcagggtgcaagacatcaatat
gtctga

DBGET integrated database retrieval system