KEGG   Nectria haematococca: NECHADRAFT_60541Help
Entry
NECHADRAFT_60541  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
nhe  Nectria haematococca
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NECHADRAFT_60541
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NECHADRAFT_60541
   00640 Propanoate metabolism
    NECHADRAFT_60541
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NECHADRAFT_60541
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NECHADRAFT_60541
Enzymes [BR:nhe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NECHADRAFT_60541
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NECHADRAFT_60541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 2283 aa AA seqDB search
MTEISAGAQEGANGRSVPYVNGKASYAEKFNIADHFIGGNRVENAPPSKVKDFVVQNGGH
TVITNVLIANNGIAAVKEIRSVRKWAYETFGDERAIHFTVMATPEDLQANAEYIRMADHY
VEVPGGTNNHNYANVELIVDIAERMNVHAVWAGWGHASENPKLPESLAASPKKIVFIGPP
GSAMRSLGDKISSTIVAQHADVPCIPWSGTGVRDVAVDDKGIVTVADDIYAKGCVTSWEE
GLEKAKEIGFPVMIKASEGGGGKGIRKAEGEEGFEALYKAAASEIPGSPIFIMKLAGNAR
HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKAMEDAAVRLGKLVG
YVSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEMVSGVDLPAAQLQIAMGLPLHRIRD
IRLLYGVDPKTSSEIDFEFKNEGTALSQRRPQPKGHTTACRITSEDPGEGFKPSNGVMHE
LNFRSSSNVWGYFSVGSQGGIHSFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFR
TTIEYLVKLLETEAFEENTISTGWLDELISKRLTAERPETMLAVVCGAITKAHIASEACM
AEYRAGLEKGQVPSKDILKTVFTIDFIYEGFRYKFTATRASSDSYHLFINGSKCSVGVRA
LSDGGLLILLDGRSHNVYWKEEVGATRISVDNKTCLLEQENDPTQLRSPSPGKLVKYTVE
NGSHVRAGQTYAEVEVMKMYMPLVAQEDGVVQLIKQPGATLEAGDILGILALDDPTRVKQ
AQAFVDKLPAYGEPVVIGSKPAQRFSLLYNILNNILLGYDNSVIMLPTLKELIEVLRDPE
LPYSEWNAQFSALHARMPQKLDAQFTQIVDRAKSRHAEFPAKSLGKAFHRFLEDNVAPAD
ADMLKTTLAPLTEVIDMYSEGQRNRELSVIKGLLNQYWEVENLFMNQPQEDAVVLKLRDQ
HKDDIMKVVHTVLSHSRVSAKSSFILAILEEYRPNKPKAGNIAKNLRDTLRKLTELQSSR
PTSKVSLKAREIMIQCSLPSLEERTAQLEHILRTSVIESRYGETGWDHREPSLDIIKEVV
DSKYTVFDVLTMFFAHDDPWVSLASLEVYVRRAYRAYILKQIEYHQDESDAPLFVSWDFQ
LRKLGQSEFGLPLQSAAPSTPATPSGGEFNFKRIHSISDMSYLTHKWEDEPTRKGVIVPC
KYIDDAEDLIGKALEALATEQRQRKKHTTPGLIPDLSGKRKPVQAKQEEEELSAVVNVAI
RDSESRDDRETLERILPIVEQYKDELLARGVRRLTFICGHSDGSYPGYYTFRGPAYKEDD
SIRHSEPALAFQLELARLAKFHIKPVFTENKSIHVYEGIGKTVDTDKRYFTRAVIRPGRL
RDEIPTAEYLISEADRVVNDIFDALEIIGNNNSDLNQVFINFTPVFQLQPKEVEESLQGF
LDRFGIRAWRLRIAQVEIRIICTDPQTGTPYPLRVVITNTSGYVVDVDMYAERKSEKGEW
VFHSIGGTHEKGPMHLLPVSTPYATKNWLQPKRYKAHLMGTQYVYDFPELFRQAIQNTWT
KAVKLQPSLAAQQPKTGDCISFTELVLDDKDNLDEVNREPGTNTCGMVGWIFRARTPEYP
NGRRFIVIANDITYKIGSFGPKEDDFFYKCTELARKLGIPRIYLSANSGARLGLADELMG
HFKVAWNDASNQLGGFRYLYLDEEAKTRFEKDVITEEVSEDGEKRHKIVTIIGKEEGLGV
ECLRGSGLIAGATSRAYNDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIILTGAPAL
NNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDFAGVSKIVEWMSFVPEKRNSPVPVSP
SVDDWDRDITYFPPQKQPYDVRWMIGGREGEDGFESGLFDKDSFVEALGGWAKTVVVGRA
RLGGIPMGVIAVETRSVENITPADPANPDSIEQVSNEAGGVWYPNSAFKTAQAINDFNNG
EQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVKYEQPIFIYIPPFGELRGGSWVV
VDPTINPTAMEMYADVEARGGVLEPEGIIGIKYRKDKQVKTMERMDPEYASLKKQLEDLS
LSTEETDEIKKKMAIREKQLLPVYAQIAVQFADLHDRAGRMKAKGVIRDSLEWTNARRYF
YWRLRRRLNEEYIIRRMTSTIISTSHSQTAAKNAETRAKYLHLLRSWSGIVDWEKDDQAV
TEWYETERKTIGEKVDSLKSEVLAAEVASVVRGHAKAGWTGVREVLRVMPVEEREQILKY
LQQ
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatctcagctggtgcccaggagggtgccaatgggcggtcggtgccctacgtc
aatggcaaggcgtcgtatgcagagaagttcaatatcgcagaccacttcatcggcggaaac
cgagtagagaatgcgccccccagcaaggtcaaggactttgttgtccagaacggcggtcac
accgttattaccaacgtcctcattgcgaacaacggtatcgccgccgtcaaggagatccga
tcagtccgaaaatgggcctacgaaacgttcggcgacgagcgagccattcacttcactgtg
atggctacccccgaagatctgcaggccaacgcagagtacattcgaatggccgaccactac
gtcgaggttcccggcggcaccaacaaccacaactatgccaacgtcgagctgattgtggat
attgctgagcgcatgaatgtccatgccgtgtgggctggatggggccacgcctccgagaac
cccaagctgccagagtcgctggccgcctccccaaagaagatcgtcttcatcggtcccccc
ggctccgccatgcgatcactaggcgacaagatctcctccacaatcgtagcacaacacgcc
gacgtgccttgcattccctggtcgggaactggcgtcagagacgtcgctgtcgacgacaag
ggcattgtcaccgttgccgacgacatctacgccaagggatgcgtgacctcgtgggaggaa
ggtctggagaaggccaaggagattggcttccccgtcatgatcaaggcctccgagggtggt
ggtggtaagggtattcgaaaggccgaaggtgaggagggtttcgaggctctctacaaggcc
gccgccagcgaaattcctggctctcccatcttcatcatgaagctcgccggcaacgcccga
catctcgaagtccagctgctcgctgatcagtacggcaacaacatctccctcttcggccga
gattgctccgttcagcgacgtcaccagaagattattgaggaggctcccgtcaccattgcg
aagcccgacacgttcaaggccatggaggacgccgctgtccgtctcggtaagctggtcggt
tacgtctccgccggtactgttgagtacctctactcccacgccgacgacaagttctacttc
ctggagctcaacccccgtctccaggtcgagcatcctaccacggagatggtcagtggtgtc
gatctgcctgctgctcagctgcagattgctatgggtcttccccttcaccgcatccgcgat
attcgactcctgtacggcgtcgaccccaagacgtcgagcgagatcgacttcgaattcaag
aacgagggcactgctctgagccagcgacgaccccagcccaagggccacaccaccgcttgc
cgaatcacttctgaggatcccggtgagggtttcaagccttccaacggtgtcatgcacgag
ctcaacttcaggagtagctccaacgtctggggttacttctccgtcggttcgcagggtggt
attcacagtttctcggactctcagttcggtcacattttcgcttatggcgagaaccgttct
gcttcgcggaagcacatggttatggctctcaaggagctgagcattcgtggtgatttccga
accaccatcgagtacctcgtcaagcttctcgagaccgaggccttcgaggagaacacaatc
tccactggttggctggatgagctcatctccaagcgtcttaccgctgagcgacctgagact
atgctcgccgttgtctgtggtgccatcaccaaggctcacattgccagtgaggcttgcatg
gccgagtatcgcgctggcctcgagaagggtcaggttccctccaaagatatccttaagacg
gtcttcaccatcgacttcatctacgagggtttccgatacaagttcaccgctacccgtgcc
agctctgacagctaccatctcttcatcaacggctccaagtgctcggttggcgttcgtgct
ctgagcgacggtggtctccttatcctgctcgacggacgaagccacaatgtctactggaag
gaggaagttggcgccacccgtatatccgtcgacaacaagacctgcctgttggagcaggag
aacgaccctacccagcttcgctctcctagccctggtaagctcgtcaagtacactgtcgag
aacggttcccacgtccgagctggtcagacctatgctgaggtcgaggtcatgaagatgtac
atgcccctcgtcgctcaggaagatggtgttgtccagctcatcaagcagcccggagccacc
ctcgaggctggtgacatccttggtatccttgctctggatgatcccacccgcgtgaagcag
gcccaggctttcgttgacaagctccctgcctacggcgagcctgttgtcattggttccaag
cccgctcagcgcttctccctcctctacaacatcctcaacaacatcctcctcggctacgac
aactctgtcattatgctgcctaccctcaaggagctcattgaggttctccgagaccctgag
ctgccttacagcgagtggaacgctcagttctctgccctccacgcccgcatgccccagaag
ctcgacgcccagttcactcagatcgtcgaccgcgccaagtcccgacatgccgagttccct
gccaagtcccttggcaaggctttccaccggttcctcgaggacaatgtcgctcctgctgat
gccgacatgctcaagaccaccctcgctccccttactgaggtcatcgacatgtactctgag
ggccagaggaaccgtgagctttccgtcatcaagggtcttctcaaccagtactgggaggtt
gagaacctcttcatgaatcagcctcaggaggatgctgttgttcttaagctccgtgaccag
cacaaggacgacatcatgaaggttgttcacactgtcctgtctcatagccgtgtgagcgcc
aagagctccttcatcctggctattctcgaggagtaccgccccaacaagcccaaggccggc
aacattgccaagaaccttcgcgacactcttcgcaagctcaccgagctccagtcttcgcgc
cccacctccaaggtctctctcaaggcccgtgagatcatgatccaatgctctcttccttcc
ctcgaggagagaactgcccagctggagcacatcctgcgcacctcagttatcgagtcccga
tacggtgagactggctgggaccacagagagcctagcctggacatcatcaaggaggtcgtc
gactccaagtacactgtcttcgacgtcttgaccatgttcttcgctcacgatgacccctgg
gtgtctctggcttctcttgaggtttacgttcgccgtgcgtaccgtgcctacatcctcaag
cagattgagtaccaccaggacgagtctgatgctcccctgtttgtctcttgggacttccag
cttcgcaagctcggccagtccgagttcggtctgcccctgcagtctgctgctccctctacc
cctgctacccccagcggaggcgagttcaattttaagcgaattcactcgatcagcgatatg
tcctacctcacccacaagtgggaggatgagcctactcgcaagggtgtcattgttccttgc
aagtacatcgacgatgctgaggatctcatcggcaaggctcttgaggctctggctactgag
cagaggcagaggaagaagcacaccactcccggtcttatccctgacctgagtggcaagcgc
aagcccgtccaggccaagcaggaggaggaggagctgtccgctgttgtcaacgtcgctatc
cgcgattctgagagccgcgatgatcgtgagactcttgagcgcatcctgcctatcgttgag
cagtacaaggatgagctcctcgctcgaggtgtccgtcgtctgactttcatctgtggtcac
agcgatggctcctaccccggatactacaccttccgaggacctgcgtacaaggaagatgac
agcattcgtcacagcgagcccgctcttgctttccagcttgagcttgctcgtctggccaag
ttccacatcaagcctgttttcactgagaacaagagtatccacgtttacgagggtattggc
aagactgtggacactgacaagcgatactttactcgtgctgtcatccgacctggtcgtctt
cgggacgagatccctactgccgagtatctcatctctgaggctgaccgtgtcgtcaacgac
atctttgatgccctggagattatcggcaacaacaactccgatctgaaccaggtcttcatc
aacttcacccccgtgttccagctccagcccaaggaggttgaggagtctctgcagggcttc
cttgatcgattcggtatccgagcttggcgcctccgtatcgcccaggtcgagatccgcatt
atttgcacggatccccagaccggaactccttaccctctccgtgttgtcattaccaacacc
tccggatatgtcgtcgacgtcgacatgtacgctgagcgcaagtcggagaagggcgagtgg
gtcttccacagcattggtggtacccacgagaagggtcccatgcatctgctgcccgtctct
accccctatgccaccaagaactggctccagcctaagcgatacaaggctcacctcatggga
actcagtacgtctatgatttccctgagctgttccgacaggctatccagaacacctggacc
aaggccgtcaagcttcagcccagtctggccgctcagcagcccaagactggtgactgcatc
agcttcaccgagcttgtgcttgatgacaaggacaaccttgacgaggtgaaccgtgagcct
ggtaccaacacttgtggtatggttggttggatcttccgggctcgcacccctgagtatccc
aatggccgacgattcatcgtcattgccaacgatatcacctacaagattggttctttcggc
cccaaggaagatgacttcttctacaagtgcactgagcttgctcgcaagcttggcattccc
cgtatctacctgtctgccaactctggtgctcgccttggtcttgcggatgagctcatgggc
cacttcaaggttgcttggaacgacgccagcaaccagctgggcggcttccgatacctctac
cttgacgaggaggccaaaacccgcttcgagaaggacgtcatcaccgaggaggtctctgag
gatggtgagaagcgacacaagattgtcaccatcattggtaaggaggagggtcttggtgtt
gagtgtctgaggggatccggtcttattgccggtgccaccagccgagcctacaacgacatc
ttcaccgtgaccctggtgacctgccgatcagttggtattggtgcttacctcgtccgtctc
ggtcagcgtgctgtccagattgagggtcagcccatcatcctgactggtgcccctgccctt
aacaacctgcttggtcgtgaggtgtacacctctaacctgcagctgggtggcactcagatc
atgtaccgcaacggtgtctcccacatgaccgctaacgacgactttgctggtgtctccaag
attgtcgagtggatgtcgtttgttcccgagaagcgcaacagccccgtgcccgtcagccct
agcgtggatgactgggatcgtgacatcacctacttccctccccagaagcagccctatgat
gtccggtggatgattggtggccgcgagggtgaggacggtttcgagtctggtctgttcgac
aaggactcgttcgtcgaggctctcggtggctgggccaagactgttgttgtcggtcgtgct
cgtcttggtggtatccccatgggtgtcattgctgtcgagactcgatcggttgagaacatt
actcctgccgaccctgccaaccctgactctatcgagcaggtcagcaacgaggccggtggt
gtgtggtaccccaactctgccttcaagactgcccaggctatcaacgacttcaacaacggt
gagcagctgcccctgatgatccttgccaactggcgtggtttctctggtggtcagcgagac
atgtacaacgaggtgctcaagtatggatctttcatcgtcgatgccctcgtcaagtacgag
cagcccatcttcatctacattcctcccttcggtgagctccgtggtggatcttgggtcgtc
gtcgaccctaccatcaaccccacagctatggagatgtacgccgatgtcgaggcccgtggt
ggtgtccttgagcccgagggtatcattggtatcaagtaccgcaaggacaagcaggtcaag
accatggaacgcatggatcctgagtatgcctccctcaagaagcagctcgaggacctcagc
ctgtctaccgaggagaccgacgagattaagaagaagatggccatccgcgagaagcagctg
ctgcccgtgtacgcccagatcgccgttcagttcgccgacctgcacgaccgtgctggccgc
atgaaggccaagggtgttatccgagactctcttgagtggaccaacgctcgtcgctacttc
tactggcgtctccgccgccgtctcaacgaggagtacatcatccgccgcatgacctcgacc
atcatcagcacttcgcacagccagactgctgctaagaacgccgagacgcgtgccaagtac
ctgcaccttctccgcagctggtcgggtatcgtcgactgggagaaggatgatcaggccgtg
actgagtggtatgagactgagcgcaagactattggtgagaaggttgattctctcaagtct
gaggtgctggctgccgaggttgccagtgttgtccgaggccacgctaaggctggctggact
ggtgttcgtgaggtgctgagagtcatgcccgttgaggagcgggagcagattctcaagtat
ctccagcagtag

DBGET integrated database retrieval system