KEGG   Nectria haematococca: NECHADRAFT_60667Help
Entry
NECHADRAFT_60667  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nhe  Nectria haematococca
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NECHADRAFT_60667
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NECHADRAFT_60667
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NECHADRAFT_60667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 325 aa AA seqDB search
MNTGLIDSRFLSKPEELGVVAVGFSGGQPKAGVDDGPSALIEAGLLSEIREELGYKIFGD
ETVQQFDDIVPESDPDYRGMKKARHASAVTRKIASQTYEHSREGRMTLTLGGDHSIAIGT
IAGTAKATRERLNREIAVIWVDAHSDINTPESSDSGNIHGMPVAFLTGLAKDDNEEYFGW
LEDDMRLSVKKLVYIGLRSVDVGERKILREHGIKAYSMHDVDRHGIGRVVEMALAHIGND
TPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDYICEAVHQTGNLVAVDLVEVNPKLAD
GKQAEQDTIRAGCSLVRCALGDTLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacactggtctcattgacagccgcttcctctccaagcctgaggagcttggtgttgtt
gccgttggattctctggcggtcagcccaaggccggtgtcgacgacggcccttccgcgctt
atcgaggctggtctcctttctgagatccgagaggagctcggctacaagatctttggcgat
gagaccgtccagcagttcgacgacattgtccccgagtcggaccccgactaccgtggcatg
aagaaggcccgccacgcctcggccgtcacccgcaagatcgcctctcagacctatgagcac
tcccgagagggccgcatgactctcactctcggtggtgaccacagcattgccattggaacc
attgccggcactgccaaggccacccgtgagcgtctcaaccgcgagatcgccgtcatttgg
gtcgatgctcattccgacatcaacacccctgagagcagcgacagcggcaacatccacggc
atgcccgtggccttcctcactggccttgccaaggatgacaacgaggagtactttggatgg
ctcgaggatgacatgcgcctgagcgtcaagaagctcgtctacattggtcttcgctctgtt
gatgttggtgagcgaaagatcctccgtgagcacggcatcaaggcctatagcatgcacgac
gtcgaccgccacggcattggccgcgtcgtcgagatggccctcgcccacatcggcaacgac
acccccatccacctgtccttcgacgtcgacgccctcgaccccatgtgggctcccagcacc
ggaactcccgtccgaggcggtctcacccttcgcgagggtgactacatctgcgaggctgtt
caccagaccggcaaccttgtggccgtcgacctggtcgaggtgaaccccaagctggccgac
ggcaagcaggctgagcaggacactatccgtgccggatgctccctggtgcggtgcgccctt
ggtgacaccctcctgtaa

DBGET integrated database retrieval system