KEGG   Nectria haematococca: NECHADRAFT_60884Help
Entry
NECHADRAFT_60884  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
nhe  Nectria haematococca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nhe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nhe00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nhe00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 717 aa AA seqDB search
MEAIRQTFQRCKSQNRSALVSYVTAGYPKPEDTPDILLALEKGGADVLELGAPFTDPIAD
GPTIQTANTIALDNGVTIESTLGMVKAARDRGLKAPVLLMGYYNPLLSYGEERLLEDCKT
SGVNGFIVVDLPPEEAISFRKLCNKGHLSYVPLIAPATSDTRMKILCQLADSFIYVVSRM
GVTGATGTLNANLPALLERVKKYSGNKPAAVGFGVSTREHFLSVATLADGVVVGSQIITT
IKNAEPGQALADIEKYCAYLSGRDSEENTREVGLVEAVAGAKEPSGDNVTVEATVTDNDI
SAEEDSALVAQLAALHGKIPERFGEFGGQYVPESLMDCLSQLEDGFNAIKDDPAFWEEYR
SYYEYMGRPGHLHLADRLTEHAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTRI
IAETGAGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMRLLGAKVVAVEAGSKTL
RDAVNEALRAWVVDLETTHYIIGSAIGPHPFPTIVRTFQSIIGRETKEQMLEKRGKLPDA
VVACVGGGSNAVGMFYPFEDDPSVKLLGVEAGGDGVETLRHSATLTGGSKGVLHGVRTYV
LQDKHGQISETHSVSAGLDYPGVGPELSSWKDNERAKFIAATDAQAFLGFRLMSQLEGII
PALESAHGIYGAIELAKTMKKGEDLVICLSGRGDKDVQSVADELPKLGPKIGWDLRF
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatcagacaaactttccagcgctgcaagtcgcagaacaggtctgcgctggta
tcatatgtcactgctggatatcccaagcctgaggacacccccgatatcctcctggctttg
gaaaagggtggtgccgatgttctcgagctcggtgctccctttaccgacccaattgccgac
ggcccgaccattcagactgccaacacgattgctctcgacaatggcgtcacgatcgagtcc
accctcggcatggtcaaggcggcccgagaccgcggtctgaaggctcctgtcctgctcatg
ggctactacaacccccttctcagctacggtgaggagcgactcctcgaggattgcaagact
tctggtgtcaatggcttcatcgttgtcgatttgcctcccgaggaggccatctccttccga
aagctgtgcaacaagggccacctttcttacgtccccctcatcgctcccgctacttctgat
acccgaatgaagattctctgccaactggccgattctttcatctatgtcgtatcaagaatg
ggtgttactggcgctaccggaactctcaatgccaacctccccgctcttctggagcgagtt
aagaagtacagcggcaacaagcccgccgctgttggattcggtgtcagcacccgtgaacac
ttcctgagtgtcgctacccttgccgatggtgtcgtcgttggcagccagattatcacaact
atcaagaacgccgagcctggtcaggctctcgccgatattgagaagtactgcgcctatctg
tcgggccgcgattcggaggagaacacccgggaggttggtctcgttgaggctgttgccgga
gccaaggagcctagcggagacaatgtcactgtcgaggcaactgtgacggataacgatatc
agcgccgaggaggatagtgccctggttgctcagctcgccgctctgcacggcaagattcct
gagcgattcggcgagttcggtggtcagtacgttcccgagagcttgatggactgtctgtca
caactggaggacggattcaacgctatcaaggacgaccctgctttctgggaggagtaccgg
tcttactacgagtacatgggacgacccggccatctgcatctggctgatcgtctgactgag
cacgctggcggcgccaacatctggctgaagcgtgaggatctgaaccacactggtagccac
aagatcaacaacgctctgggacagctcctcctggctcgaagactcggaaagacccgcatt
atcgctgagaccggtgctggtcagcatggtgttgctactgccactgtctgtgccaagttt
ggcatggagtgcacagtttatatgggcgctgaggatgtccgacgacaggctctcaacgtt
ttccgtatgcgactgctcggcgccaaggttgtcgctgttgaggctggaagcaagaccctt
cgagatgccgtcaacgaggccctccgcgcctgggtcgttgaccttgaaaccacccactac
attatcggttccgccatcggtcctcaccccttccccaccatcgtgcggacgttccagtcc
atcatcggccgcgagaccaaggaacagatgctcgagaagcgaggaaagctccccgacgcc
gtcgtggcctgtgtcggtggaggcagcaacgctgtcggcatgttctaccccttcgaagac
gatcccagtgttaagctcctgggtgttgaggctggtggtgacggtgttgagacattaaga
catagcgctaccctcaccggtggttccaagggtgtcctgcacggtgtgaggacgtacgtc
ctccaggacaagcacggccagatttccgagacacactccgtctccgctggtcttgactac
cccggtgtcggccctgagctgagctcctggaaggataatgagcgagccaagttcattgcc
gccactgacgcccaggctttcctcggtttcagactcatgagccagcttgagggtatcatc
cccgctctcgagtcggcacacggcatctacggtgccattgagctggccaagacgatgaag
aagggcgaggatctggtcatctgcctgagtggtcgtggtgacaaggatgtgcagagcgtg
gcggatgagcttcccaagctgggacccaagattggatgggatctccgtttctaa

DBGET integrated database retrieval system