KEGG   Nectria haematococca: NECHADRAFT_60884Help
Entry
NECHADRAFT_60884  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
nhe  Nectria haematococca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NECHADRAFT_60884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NECHADRAFT_60884
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NECHADRAFT_60884
Enzymes [BR:nhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NECHADRAFT_60884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 717 aa AA seqDB search
MEAIRQTFQRCKSQNRSALVSYVTAGYPKPEDTPDILLALEKGGADVLELGAPFTDPIAD
GPTIQTANTIALDNGVTIESTLGMVKAARDRGLKAPVLLMGYYNPLLSYGEERLLEDCKT
SGVNGFIVVDLPPEEAISFRKLCNKGHLSYVPLIAPATSDTRMKILCQLADSFIYVVSRM
GVTGATGTLNANLPALLERVKKYSGNKPAAVGFGVSTREHFLSVATLADGVVVGSQIITT
IKNAEPGQALADIEKYCAYLSGRDSEENTREVGLVEAVAGAKEPSGDNVTVEATVTDNDI
SAEEDSALVAQLAALHGKIPERFGEFGGQYVPESLMDCLSQLEDGFNAIKDDPAFWEEYR
SYYEYMGRPGHLHLADRLTEHAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTRI
IAETGAGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMRLLGAKVVAVEAGSKTL
RDAVNEALRAWVVDLETTHYIIGSAIGPHPFPTIVRTFQSIIGRETKEQMLEKRGKLPDA
VVACVGGGSNAVGMFYPFEDDPSVKLLGVEAGGDGVETLRHSATLTGGSKGVLHGVRTYV
LQDKHGQISETHSVSAGLDYPGVGPELSSWKDNERAKFIAATDAQAFLGFRLMSQLEGII
PALESAHGIYGAIELAKTMKKGEDLVICLSGRGDKDVQSVADELPKLGPKIGWDLRF
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatcagacaaactttccagcgctgcaagtcgcagaacaggtctgcgctggta
tcatatgtcactgctggatatcccaagcctgaggacacccccgatatcctcctggctttg
gaaaagggtggtgccgatgttctcgagctcggtgctccctttaccgacccaattgccgac
ggcccgaccattcagactgccaacacgattgctctcgacaatggcgtcacgatcgagtcc
accctcggcatggtcaaggcggcccgagaccgcggtctgaaggctcctgtcctgctcatg
ggctactacaacccccttctcagctacggtgaggagcgactcctcgaggattgcaagact
tctggtgtcaatggcttcatcgttgtcgatttgcctcccgaggaggccatctccttccga
aagctgtgcaacaagggccacctttcttacgtccccctcatcgctcccgctacttctgat
acccgaatgaagattctctgccaactggccgattctttcatctatgtcgtatcaagaatg
ggtgttactggcgctaccggaactctcaatgccaacctccccgctcttctggagcgagtt
aagaagtacagcggcaacaagcccgccgctgttggattcggtgtcagcacccgtgaacac
ttcctgagtgtcgctacccttgccgatggtgtcgtcgttggcagccagattatcacaact
atcaagaacgccgagcctggtcaggctctcgccgatattgagaagtactgcgcctatctg
tcgggccgcgattcggaggagaacacccgggaggttggtctcgttgaggctgttgccgga
gccaaggagcctagcggagacaatgtcactgtcgaggcaactgtgacggataacgatatc
agcgccgaggaggatagtgccctggttgctcagctcgccgctctgcacggcaagattcct
gagcgattcggcgagttcggtggtcagtacgttcccgagagcttgatggactgtctgtca
caactggaggacggattcaacgctatcaaggacgaccctgctttctgggaggagtaccgg
tcttactacgagtacatgggacgacccggccatctgcatctggctgatcgtctgactgag
cacgctggcggcgccaacatctggctgaagcgtgaggatctgaaccacactggtagccac
aagatcaacaacgctctgggacagctcctcctggctcgaagactcggaaagacccgcatt
atcgctgagaccggtgctggtcagcatggtgttgctactgccactgtctgtgccaagttt
ggcatggagtgcacagtttatatgggcgctgaggatgtccgacgacaggctctcaacgtt
ttccgtatgcgactgctcggcgccaaggttgtcgctgttgaggctggaagcaagaccctt
cgagatgccgtcaacgaggccctccgcgcctgggtcgttgaccttgaaaccacccactac
attatcggttccgccatcggtcctcaccccttccccaccatcgtgcggacgttccagtcc
atcatcggccgcgagaccaaggaacagatgctcgagaagcgaggaaagctccccgacgcc
gtcgtggcctgtgtcggtggaggcagcaacgctgtcggcatgttctaccccttcgaagac
gatcccagtgttaagctcctgggtgttgaggctggtggtgacggtgttgagacattaaga
catagcgctaccctcaccggtggttccaagggtgtcctgcacggtgtgaggacgtacgtc
ctccaggacaagcacggccagatttccgagacacactccgtctccgctggtcttgactac
cccggtgtcggccctgagctgagctcctggaaggataatgagcgagccaagttcattgcc
gccactgacgcccaggctttcctcggtttcagactcatgagccagcttgagggtatcatc
cccgctctcgagtcggcacacggcatctacggtgccattgagctggccaagacgatgaag
aagggcgaggatctggtcatctgcctgagtggtcgtggtgacaaggatgtgcagagcgtg
gcggatgagcttcccaagctgggacccaagattggatgggatctccgtttctaa

DBGET integrated database retrieval system