KEGG   Nectria haematococca: NECHADRAFT_61067Help
Entry
NECHADRAFT_61067  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NECHADRAFT_61067
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NECHADRAFT_61067
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NECHADRAFT_61067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 546 aa AA seqDB search
MAANNMANPSVNPDHEDELFQKEVEAVKAWWSDSRWRHTKRPFTAEQIVSKRGYLPINYA
SNAQAKKLWNILEQRFESRDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASASDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKAQRANLLNIDYLRPIVADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPIQEHINRLVAIRAQA
DIMGSDLLAIARTDAEAATLITTTIDPRDHAFILGSTNPSLKPLNDLMIAAEQAGKNGAQ
LQRIEDEWLAQAKLSRFDDAVAAAIDAGSYSNKAGLKSDYAAKAKGKSNTEARAIASQIL
GRDIFFDWDAPRTREGYYRLKGGCDCAVNRAIAYAPYCDAIWMESKLPDFAQAKEFADGV
HAVWPEKKLAYNLSPSFNWKTAMPRQEQETYIRRLAKLGYCWQFITLAGLHTTALISDQF
AKAYSTVGMRAYGELVQEPEMDTKVDVVKHQKWSGATYVDELQKMVTGGISSTAAMGAGV
TEDQFK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaacaacatggcgaacccctccgtgaacccggatcacgaggacgagctcttc
cagaaggaggttgaggctgtcaaggcctggtggtccgactcgcgatggcgacacaccaag
cgaccttttaccgccgagcagatcgtctccaagcgaggatacctgcccatcaactacgcc
agcaacgcccaggctaagaagttgtggaacattcttgagcagcgcttcgagtcccgagat
gctagctacacctatggctgcttggagcctaccatggtcactcagatggccaagtacctc
gataccgtctacgtctctggatggcaatcatcttctaccgcctctgcttctgacgagccc
ggtcccgatctggctgattacccctacactaccgtccctaacaaggtcggccacctcttc
atggctcagctcttccacgaccgcaagcagcgccaggagcgcctgagcgtccccaaggct
cagcgtgccaacctcctcaacattgactacctccgccccatcgtcgccgatgctgacacc
ggtcacggtggtctcactgccgtcatgaagctcaccaagctcttcatcgagaagggtgct
gccggtatccacattgaggatcaggcccccggaaccaagaagtgcggccacatggctggc
aaggtccttgtccccatccaggagcacatcaaccgcctggttgccattcgcgcgcaggct
gacatcatgggctctgatctcctcgctatcgcccgtaccgacgccgaggccgccaccctc
atcaccaccaccatcgacccccgcgaccatgccttcatcctcggctccaccaacccctcc
ctcaagcccctcaacgatctcatgatcgccgctgagcaggctggcaagaacggtgcccag
cttcagcgcatcgaggacgaatggctggcccaggccaagctcagccgcttcgacgacgcc
gtcgctgccgccattgacgccggctcctactctaacaaggctggcctgaagagcgactat
gctgccaaggccaagggcaagagcaacactgaggctcgcgccatcgccagccagattctc
ggccgagacatcttcttcgactgggacgccccccgaacccgtgagggttactaccgcctc
aagggtggctgtgactgcgccgttaaccgcgccatcgcctacgccccctactgcgacgcc
atctggatggagtccaagctgcccgactttgcccaggccaaggagttcgccgacggtgtc
cacgccgtctggcctgagaagaagctcgcctacaacctgtctccctctttcaactggaag
actgccatgccccgccaggagcaggagacctacatccgccgcctcgctaagctcggctac
tgctggcagttcatcaccctcgccggtcttcacactactgctctcatcagcgaccagttc
gccaaggcctacagcactgttggcatgcgcgcctacggcgagctcgtccaggagcccgag
atggacaccaaggtcgacgttgtcaagcaccagaagtggagtggtgctacctacgtcgat
gagctccagaagatggtcaccggtggtatcagctctaccgctgccatgggtgctggtgtg
actgaggaccagttcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system