KEGG   Nectria haematococca: NECHADRAFT_61076Help
Entry
NECHADRAFT_61076  CDS       T01612                                 

Definition
hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 507 aa AA seqDB search
MADPFAPRSMKRKNVKGLALKAAAPRPPPTAETNRHEFNSGSQDAGKDEQLEIGIEYKLD
LRPEDLEIVKELGSGNGGTVSKVRHLTTGTVMARKVIHVEAKREIRKRIVRELQIMHGCH
SDYIVTFYGAFLNPNNDVIMCMEYMDVGALDRVSKVFGPVRVDVLGKIAEATLGGLTYLY
TKHHIMHRDIKPSNILVNSRGHIKLCDFGVSGELVNSIADTFVGTSTYMAPERIQGEKYT
VKSDVWSFGLSIMELAIGKFPFAASEQLSDGDCAPAGILDLLQQIVHEPAPKLPKSDAFP
SILEDMIQKCLYKEPELRPTPQELFDRDPFVQAAKRTPVDLREWAIGLIERDNRKSHLAP
QLSPATQELLRSSDSPTQSQPQPEDRSHTPTSGEIPIAGAGIISPRDQYGSSHSRSPPRN
GYGSARTPGSAHPGLPRVVTTNSIPKVSGYPESAGPMSANATTFSLPVRPAPPGGPLPPP
PPRKETPDELRRENRRFGLPPNPGYGV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccctttgctccgcgctccatgaagcgcaaaaatgtcaaaggccttgccctc
aaagccgccgcccctcgacccccaccaaccgccgaaaccaaccgacacgagttcaactcg
gggagccaagatgcgggcaaggacgagcagttggagattggaatcgagtacaagctggat
ctgagacccgaagacctcgagatcgtcaaggagctgggttctggcaacggcggcaccgtt
agcaaagtcaggcacctcacaacaggaactgtcatggcccgcaaggtcattcatgtcgaa
gccaagcgagagatacggaagcgaatcgttcgagaactccagattatgcatggatgccac
tccgactacatcgttacattctacggtgcctttttgaatcccaacaacgatgttattatg
tgcatggaatacatggacgttggtgcccttgaccgagtctcgaaggtgtttggtcctgtt
cgcgtcgatgtgctgggaaagattgccgaagccaccctcggcggattgacatatctctac
acgaaacatcacatcatgcatcgtgatatcaagccatccaatattctcgtcaactcgaga
ggccatatcaagctctgcgattttggtgtttcgggcgagctcgtcaactccatcgccgac
acctttgttggaacctctacttacatggcccccgaacgaatccagggagaaaagtacact
gtcaagtcggatgtctggagtttcggtctcagcattatggagcttgccattggcaagttc
ccctttgcggcgagcgagcagctgtcagatggtgactgcgcccctgctggtatcctggat
ctgctccagcagattgtccatgagccggcgccaaagctccctaagagcgatgcattcccc
agcatcctcgaggacatgatccagaagtgtctctataaggagcctgaacttcggccaact
ccccaggagcttttcgatcgcgatccctttgttcaagccgccaagagaacaccagtcgat
cttcgagagtgggctattggactgattgagcgtgacaaccggaaatcccatcttgcccct
caactctctcccgcgactcaggagctcctccggtcgagcgattcccctactcagagccag
ccgcaacccgaagaccgaagccatactcccacctctggcgagatccccattgctggggct
ggaattatctcacctcgggatcagtacggctcgagccacagtcgatcgccacctcgcaac
ggttatggctctgcccgcacaccgggctcggcgcatcctggactgccccgtgtcgtcacg
acaaactcgatccccaaggtgtcgggctaccctgagagcgctggccctatgagcgcaaat
gctacgacattcagcctgcctgtccgaccagctccccctggtggccctctcccccctccc
ccacctcgaaaggagactcccgacgagctccgaagggagaaccgaagatttggactgccg
ccaaacccgggctatggcgtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system