KEGG   Nectria haematococca: NECHADRAFT_61337Help
Entry
NECHADRAFT_61337  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
nhe  Nectria haematococca
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NECHADRAFT_61337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 357 aa AA seqDB search
MSTLFGGASSSSTSTTVGDLKADVALEMPPTDSVSDLAFSPAPNGPDYLAVSSWDSKVRI
YEIDGNGRSQGRHVYEHSQPVLNVDFSKDGTKIASAGADKNVKVCDLASQQDMVVGTHDQ
PVRTVRFFDSGNGPMVVSGSWDKTVKYWDLRQQQPAATLSCQERVYTMDVRDNLCVVGTA
DRYINVIDLKNPTKFYKTLQSPLKWQTRVVSCFTDSAGFAIGSIEGRCAIQYVEDKDSSS
NFSFKCHRDPPANSVTNVYAVNDISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPNVG
GSITATTFNKNGSIFAYAVSYDWAKGYQHNTQNYPIKVMLHPVTNDECKPRPSMKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacactctttggtggcgcgtcgagctcgtcgacgagcaccaccgtcggcgacctc
aaggctgatgtcgcgctcgaaatgcctcccaccgacagcgtctccgacctggccttctct
cccgcgcccaacggccccgactacctcgccgtctctagttgggactccaaggtccgcatc
tacgagattgatgggaatggccggagccaaggtcgtcatgtctacgagcattcccaaccc
gttctgaatgtcgacttttccaaggacggaaccaagatcgcctcagcaggcgctgacaag
aacgtcaaggtctgcgacctcgcctcgcagcaagacatggtcgttggaacgcacgaccag
cccgtgcggacggtccgcttcttcgacagcggcaacgggcccatggtggtctctggctcc
tgggacaagacggtcaagtactgggacctgcggcagcagcagccggccgcgaccctgtcc
tgccaggagagggtctataccatggacgtccgcgacaatctctgcgtcgtgggaaccgcc
gaccggtacatcaacgtcatcgacctcaagaaccctaccaaattctacaagactctgcag
agcccgcttaaatggcagaccagggtggttagctgcttcactgactctgcgggctttgct
attggtagtattgagggtcgttgcgcgattcagtatgtcgaggacaaggactcgagctcc
aacttctccttcaagtgtcaccgtgaccccccagccaacagcgtcaccaacgtctacgcc
gtcaacgatatctcgttccaccccgtccacggcaccttcagcacggccggctccgacggt
acgttccacttctgggacaaggacgccaagcaccgtctcaagggctaccccaacgtgggc
ggcagcatcacggccaccacctttaacaagaacggaagcatctttgcctacgccgttagt
tacgactgggccaagggctaccagcacaacactcagaactaccccatcaaggtgatgctg
caccccgtcaccaacgacgagtgcaagcccaggccgtccatgaagaagcggtag

DBGET integrated database retrieval system