KEGG   Nectria haematococca: NECHADRAFT_61439Help
Entry
NECHADRAFT_61439  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
nhe  Nectria haematococca
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NECHADRAFT_61439
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NECHADRAFT_61439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 652 aa AA seqDB search
MVQLWSVSAIFALHILRLEAAALGNEPRYAVSTDLQIRALPDSPSGGYSPEVVDCPRTRP
TIRSADALSDEETSWISVRRNNTFDPLRKLLENAAIPNFNASSYLDRNRDNTTAIPNIGI
AVSGGGYRALMNGAGFLSAADSRNGHDSAVSGLLQASTYLAGLSGGGWLVGSMFANNFST
IPDLQKGEEDSSNWRFDRSIFKGPKESGIGALNTVDYWSEIATDVGNKSEGWDTSITDYW
GRALSYQLINADQGGPAYTFSSIQDTSAFKDADTPFPILVADGRAPGDFIVSLNATVFEF
NPYELGTWDPTTYGFAPLRWLASNFTNGSISRNGKCVRGFDQFGFVMGTSSSLFNQFLLQ
NVSALGEDSGIPSFITDALENILKGLSDDENDIAQYAPNPFRGWNPDTNPNSKDFQLSLV
DGGEDLQNIPLHPLIQPNRGVDIIFAVDSSADTTYNWPNGTALRASYDRSLEDIGNGTLF
PPVPSAETFINNGLNQRPTMFGCDANNFTLSRGQVVPPIVVYVPNAPYTASSNVSTFTPS
YSITQRDQIITNGFNSATQGNGTVNKDWPVCVACAIMSRSWWKAGETVPDACQTCFDKYC
WDGKTNNTRVNDYEPSFIIKNESGDSDNAAAGLGHNFALTVGVALAVVFFGY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggtccagctatggtccgtctcggcgattttcgccctgcacattctccgtcttgaagcg
gcagccctcggaaacgaacctcgttatgcggtatctacggatttgcagatccgagctctt
cccgactctcccagtggtggctactctccagaggttgtcgactgtcctcgcacgcgacct
accattcgctcagcagatgctctctcggatgaggaaacctcgtggatttctgtccgcaga
aacaacacctttgatcctctgcgtaagcttcttgagaatgccgccatccccaacttcaac
gcgagttcctaccttgacaggaaccgcgacaacaccacagccatccccaacattggcatc
gcagtctctggcggtggctatcgcgccctgatgaacggagccgggttcctgtcagctgcc
gactcacgtaacggacacgacagcgccgtcagcgggcttttgcaggcgtcgacttacctt
gccgggctatccggtggtggctggctcgtggggtcaatgtttgccaacaacttctccacc
atccccgatctgcaaaagggcgaagaagactcttccaactggcgatttgaccgatctatt
ttcaagggaccaaaggagagtggtattggagctttgaacacggtcgattactggtctgag
attgcgaccgacgttggcaacaagagtgagggctgggacacttccatcaccgattactgg
ggccgtgccctgtcgtatcagctcatcaatgccgatcaaggtggtcccgcgtatacgttt
tcttcaatccaggatacgtccgccttcaaggatgccgacacgcctttcccgattcttgtt
gccgacggaagagctcctggagactttattgtatccttgaacgccaccgtcttcgagttt
aacccttacgagcttggcacctgggatcctaccacttacggatttgctccgctgcgttgg
ttggcgtccaacttcactaatggttccatttcgcgcaatggaaaatgtgtacgcggattt
gatcagtttggctttgtcatgggtacttcttcatctctcttcaaccagtttctgcttcaa
aacgtctccgctcttggcgaggactctggtatcccatctttcatcacagatgctcttgag
aacatcctcaagggtctcagcgacgatgagaatgacattgcccagtacgcacctaacccg
ttccgaggctggaaccccgacacgaaccccaacagcaaggatttccaactctcgctggta
gacggtggtgaggatctgcagaatattcccctgcacccgttgattcagcccaatcgtggt
gtggacatcatctttgctgtcgactcgtctgccgatactacatacaactggccaaacggc
actgctctgcgagcttcctatgaccgttctctggaggatattggcaacggtaccctgttc
cctcctgtgccttctgccgagactttcatcaacaacggccttaaccaacgtcctaccatg
tttggctgcgacgccaacaactttacactctccagaggacaggttgtgccgcccattgtt
gtctacgtaccgaatgcaccctacacggcctctagtaacgtctcgacattcacgccatct
tatagcatcacacagcgcgaccagatcatcacaaacggcttcaactcggccacccaaggc
aacggcactgtgaacaaggactggcccgtttgcgttgcctgtgccatcatgagccgaagc
tggtggaaggccggagagactgttcctgatgcatgccagacttgctttgacaagtactgc
tgggacggcaagactaacaatactcgagtcaatgactatgagcctagcttcattattaag
aatgagagtggggatagtgacaacgctgccgctggacttggacataactttgcgcttact
gttggagttgccttggctgttgtgttctttggatactaa

DBGET integrated database retrieval system