KEGG   Nectria haematococca: NECHADRAFT_61439Help
Entry
NECHADRAFT_61439  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
nhe  Nectria haematococca
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nhe00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 652 aa AA seqDB search
MVQLWSVSAIFALHILRLEAAALGNEPRYAVSTDLQIRALPDSPSGGYSPEVVDCPRTRP
TIRSADALSDEETSWISVRRNNTFDPLRKLLENAAIPNFNASSYLDRNRDNTTAIPNIGI
AVSGGGYRALMNGAGFLSAADSRNGHDSAVSGLLQASTYLAGLSGGGWLVGSMFANNFST
IPDLQKGEEDSSNWRFDRSIFKGPKESGIGALNTVDYWSEIATDVGNKSEGWDTSITDYW
GRALSYQLINADQGGPAYTFSSIQDTSAFKDADTPFPILVADGRAPGDFIVSLNATVFEF
NPYELGTWDPTTYGFAPLRWLASNFTNGSISRNGKCVRGFDQFGFVMGTSSSLFNQFLLQ
NVSALGEDSGIPSFITDALENILKGLSDDENDIAQYAPNPFRGWNPDTNPNSKDFQLSLV
DGGEDLQNIPLHPLIQPNRGVDIIFAVDSSADTTYNWPNGTALRASYDRSLEDIGNGTLF
PPVPSAETFINNGLNQRPTMFGCDANNFTLSRGQVVPPIVVYVPNAPYTASSNVSTFTPS
YSITQRDQIITNGFNSATQGNGTVNKDWPVCVACAIMSRSWWKAGETVPDACQTCFDKYC
WDGKTNNTRVNDYEPSFIIKNESGDSDNAAAGLGHNFALTVGVALAVVFFGY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggtccagctatggtccgtctcggcgattttcgccctgcacattctccgtcttgaagcg
gcagccctcggaaacgaacctcgttatgcggtatctacggatttgcagatccgagctctt
cccgactctcccagtggtggctactctccagaggttgtcgactgtcctcgcacgcgacct
accattcgctcagcagatgctctctcggatgaggaaacctcgtggatttctgtccgcaga
aacaacacctttgatcctctgcgtaagcttcttgagaatgccgccatccccaacttcaac
gcgagttcctaccttgacaggaaccgcgacaacaccacagccatccccaacattggcatc
gcagtctctggcggtggctatcgcgccctgatgaacggagccgggttcctgtcagctgcc
gactcacgtaacggacacgacagcgccgtcagcgggcttttgcaggcgtcgacttacctt
gccgggctatccggtggtggctggctcgtggggtcaatgtttgccaacaacttctccacc
atccccgatctgcaaaagggcgaagaagactcttccaactggcgatttgaccgatctatt
ttcaagggaccaaaggagagtggtattggagctttgaacacggtcgattactggtctgag
attgcgaccgacgttggcaacaagagtgagggctgggacacttccatcaccgattactgg
ggccgtgccctgtcgtatcagctcatcaatgccgatcaaggtggtcccgcgtatacgttt
tcttcaatccaggatacgtccgccttcaaggatgccgacacgcctttcccgattcttgtt
gccgacggaagagctcctggagactttattgtatccttgaacgccaccgtcttcgagttt
aacccttacgagcttggcacctgggatcctaccacttacggatttgctccgctgcgttgg
ttggcgtccaacttcactaatggttccatttcgcgcaatggaaaatgtgtacgcggattt
gatcagtttggctttgtcatgggtacttcttcatctctcttcaaccagtttctgcttcaa
aacgtctccgctcttggcgaggactctggtatcccatctttcatcacagatgctcttgag
aacatcctcaagggtctcagcgacgatgagaatgacattgcccagtacgcacctaacccg
ttccgaggctggaaccccgacacgaaccccaacagcaaggatttccaactctcgctggta
gacggtggtgaggatctgcagaatattcccctgcacccgttgattcagcccaatcgtggt
gtggacatcatctttgctgtcgactcgtctgccgatactacatacaactggccaaacggc
actgctctgcgagcttcctatgaccgttctctggaggatattggcaacggtaccctgttc
cctcctgtgccttctgccgagactttcatcaacaacggccttaaccaacgtcctaccatg
tttggctgcgacgccaacaactttacactctccagaggacaggttgtgccgcccattgtt
gtctacgtaccgaatgcaccctacacggcctctagtaacgtctcgacattcacgccatct
tatagcatcacacagcgcgaccagatcatcacaaacggcttcaactcggccacccaaggc
aacggcactgtgaacaaggactggcccgtttgcgttgcctgtgccatcatgagccgaagc
tggtggaaggccggagagactgttcctgatgcatgccagacttgctttgacaagtactgc
tgggacggcaagactaacaatactcgagtcaatgactatgagcctagcttcattattaag
aatgagagtggggatagtgacaacgctgccgctggacttggacataactttgcgcttact
gttggagttgccttggctgttgtgttctttggatactaa

DBGET integrated database retrieval system