KEGG   Nectria haematococca: NECHADRAFT_62079Help
Entry
NECHADRAFT_62079  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NECHADRAFT_62079
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NECHADRAFT_62079
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_62079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 561 aa AA seqDB search
MAFHEANESDPLLSSHDRSDDADHRKAVRHSRIRELGLFVWALVATAAVIVIAVWTQHEQ
QTRHDRNVPSAKRNLVFMVSDGMGPAPLSLTRSYRQFVQGLPHDDVLTLDKHFWGSSRTR
STSSLVTDSAAGATAFSCGKKSYNGAIAVLPNHDPCGTVLEAAKRAGYHTGLVVTTKIED
ATPACFNSHVRVREMEDEIALQQIGEGALGRTVDLMLGGGRCNYLAKGTEGSCRADDTDV
IKLATEKHNWTYTDSRSGFDALKGGENVELPFLGLFAPSDIPFEIDRRNLNDIYPSLSEM
ATTALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFKAVLDFIKQ
SKTETVLVATSDHETGGLATAIQEPGHLPVYNWYPKVLANATASAEWLAAKLHVHLSSSS
NSKKDLEKLKKYINEELIIRGLGISNASDKEITTIAEHPESALVLFSALISLRAHVGWST
HGHTAVDVNIYSSGGPGTDAIRGNVENTEVGKFLRNYLDVDVDVITEELKEKMDKSLLKG
SDELDEESVLGSAEYHILESI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctttccatgaggccaacgaaagcgatcctctcttgtccagtcacgaccgctccgat
gacgcagatcatcgcaaggctgtccggcactcgcgcattcgcgagctcggcctgttcgtc
tgggctcttgtagccaccgccgcagtcatcgtcattgccgtctggacacagcacgagcag
cagacgagacacgaccgcaatgttccctcggcgaagcgaaacctcgtcttcatggtctct
gacggcatgggccccgcgccgctgtcattgacccgcagctatagacagttcgtccaaggc
ctccctcacgacgacgtcttgacgctcgacaagcatttttggggatccagccgtactcgc
tccaccagctctctcgtcaccgacagtgctgccggcgcgaccgccttctcttgcggcaag
aagagctacaatggtgccatcgccgtcctgcccaaccacgacccctgcggaaccgtgctc
gaggctgcgaaacgcgccggataccataccggtctcgttgttacaaccaagatcgaggat
gctacacctgcctgtttcaactcccatgtcagagtccgagaaatggaggacgagatcgct
ctccagcagatcggcgagggcgcccttggacgaactgtagacctcatgcttggtggtggt
cgatgcaactacctcgccaagggaactgagggcagctgccgagccgatgatacggacgtt
attaagcttgccactgagaagcacaattggacttataccgatagccgctctggctttgat
gcactcaagggcggcgagaacgtcgagcttcccttcttgggtctctttgccccctctgat
attccctttgagattgatcgccgaaacctcaacgatatctacccttctctgagtgagatg
gccacaactgctctgcgcgctcttgagaaggcgaccgagaagagcgacaagggcttcttc
atcatgatcgaggggagcagaatcgaccacgccggtcacattaacgacccggcggctcaa
gtccacgaggtcctcgagtacgacaagaccttcaaggctgttctcgacttcatcaagcag
agcaagactgaaaccgtccttgtcgcgaccagcgaccatgaaactggtggtctcgccacc
gccatccaggaacccggtcacctcccagtctacaactggtaccccaaggtccttgccaac
gctaccgcctcggctgagtggctcgcggccaagctccacgtccatctttcgtcttcatct
aactcgaagaaggacctggagaagctcaagaagtatatcaacgaggagctcatcatccgc
ggccttggtatctccaacgcctcggacaaggagatcaccaccatcgctgagcaccctgag
agcgctcttgtcctcttctcagccctcatctccctgcgggcccatgttggatggagcact
cacggacacacggccgttgatgtcaacatctacagctctggtggtccgggcaccgacgcc
atccgtggcaacgttgagaacactgaggttggaaagttcctgcgtaattacctcgatgtc
gacgtggatgtcattaccgaagaactcaaggagaagatggacaagtctcttctcaagggt
tcagatgaactagatgaggaatcggttcttggcagtgctgagtaccatatcctcgagtcg
atctag

DBGET integrated database retrieval system