KEGG   Nectria haematococca: NECHADRAFT_62079Help
Entry
NECHADRAFT_62079  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nhe00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 561 aa AA seqDB search
MAFHEANESDPLLSSHDRSDDADHRKAVRHSRIRELGLFVWALVATAAVIVIAVWTQHEQ
QTRHDRNVPSAKRNLVFMVSDGMGPAPLSLTRSYRQFVQGLPHDDVLTLDKHFWGSSRTR
STSSLVTDSAAGATAFSCGKKSYNGAIAVLPNHDPCGTVLEAAKRAGYHTGLVVTTKIED
ATPACFNSHVRVREMEDEIALQQIGEGALGRTVDLMLGGGRCNYLAKGTEGSCRADDTDV
IKLATEKHNWTYTDSRSGFDALKGGENVELPFLGLFAPSDIPFEIDRRNLNDIYPSLSEM
ATTALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFKAVLDFIKQ
SKTETVLVATSDHETGGLATAIQEPGHLPVYNWYPKVLANATASAEWLAAKLHVHLSSSS
NSKKDLEKLKKYINEELIIRGLGISNASDKEITTIAEHPESALVLFSALISLRAHVGWST
HGHTAVDVNIYSSGGPGTDAIRGNVENTEVGKFLRNYLDVDVDVITEELKEKMDKSLLKG
SDELDEESVLGSAEYHILESI
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggctttccatgaggccaacgaaagcgatcctctcttgtccagtcacgaccgctccgat
gacgcagatcatcgcaaggctgtccggcactcgcgcattcgcgagctcggcctgttcgtc
tgggctcttgtagccaccgccgcagtcatcgtcattgccgtctggacacagcacgagcag
cagacgagacacgaccgcaatgttccctcggcgaagcgaaacctcgtcttcatggtctct
gacggcatgggccccgcgccgctgtcattgacccgcagctatagacagttcgtccaaggc
ctccctcacgacgacgtcttgacgctcgacaagcatttttggggatccagccgtactcgc
tccaccagctctctcgtcaccgacagtgctgccggcgcgaccgccttctcttgcggcaag
aagagctacaatggtgccatcgccgtcctgcccaaccacgacccctgcggaaccgtgctc
gaggctgcgaaacgcgccggataccataccggtctcgttgttacaaccaagatcgaggat
gctacacctgcctgtttcaactcccatgtcagagtccgagaaatggaggacgagatcgct
ctccagcagatcggcgagggcgcccttggacgaactgtagacctcatgcttggtggtggt
cgatgcaactacctcgccaagggaactgagggcagctgccgagccgatgatacggacgtt
attaagcttgccactgagaagcacaattggacttataccgatagccgctctggctttgat
gcactcaagggcggcgagaacgtcgagcttcccttcttgggtctctttgccccctctgat
attccctttgagattgatcgccgaaacctcaacgatatctacccttctctgagtgagatg
gccacaactgctctgcgcgctcttgagaaggcgaccgagaagagcgacaagggcttcttc
atcatgatcgaggggagcagaatcgaccacgccggtcacattaacgacccggcggctcaa
gtccacgaggtcctcgagtacgacaagaccttcaaggctgttctcgacttcatcaagcag
agcaagactgaaaccgtccttgtcgcgaccagcgaccatgaaactggtggtctcgccacc
gccatccaggaacccggtcacctcccagtctacaactggtaccccaaggtccttgccaac
gctaccgcctcggctgagtggctcgcggccaagctccacgtccatctttcgtcttcatct
aactcgaagaaggacctggagaagctcaagaagtatatcaacgaggagctcatcatccgc
ggccttggtatctccaacgcctcggacaaggagatcaccaccatcgctgagcaccctgag
agcgctcttgtcctcttctcagccctcatctccctgcgggcccatgttggatggagcact
cacggacacacggccgttgatgtcaacatctacagctctggtggtccgggcaccgacgcc
atccgtggcaacgttgagaacactgaggttggaaagttcctgcgtaattacctcgatgtc
gacgtggatgtcattaccgaagaactcaaggagaagatggacaagtctcttctcaagggt
tcagatgaactagatgaggaatcggttcttggcagtgctgagtaccatatcctcgagtcg
atctag

DBGET integrated database retrieval system