KEGG   Nectria haematococca: NECHADRAFT_63014Help
Entry
NECHADRAFT_63014  CDS       T01612                                 

Definition
glycoside hydrolase family 13
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nhe  Nectria haematococca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NECHADRAFT_63014
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NECHADRAFT_63014
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_63014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 707 aa AA seqDB search
MAAIVENSSNSLDPNNTNGAADGIPNDGTGVVKLDPWLSPFSDALKRRFSKTQDWIKTIN
DNEGGLEKFSRGTEKFGLNVDANNNIIYREWAPNATEAYLIGDFNNWDRTSHPMKKGPFG
VFEITIPAKDGQAAIPHNSKIKISLTLPNGERADRLPAWIKYVTQDLNVSPAYDARFWNP
PASETYKFKHARPKKPESARVYEAHVGISSPDQRVASYKEFTQNMLPRIKDLGYNVIQLM
AVMEHAYYASFGYQVNNFFAASSRYGPPEDLKELIDTAHSMGIVVLLDVVHSHASKNVLD
GLNEFDGTDHQYFHGGGKGRHDQWDSRLFNYGHHEVMRFLLSNLRFWMDEYQFDGFRFDG
VTSMLYVHHGMGTGFSGGYHEYFGADVDEEAVVYLMLANEMLHLLYPDVITVAEDVSGMP
ALCLPLSLGGVGFDYRLAMAIPDMWIKILKELKDDDWDIGNICHTLTNRRHGEKTIAYAE
SHDQALVGDKTLMMHLCDAEMYTNMSTLSPLTPVIDRGMALHKMIRLLTHGLGGEGYLNF
EGNEFGHPEWLDFPREGNNNSFWYARRQLNLTEDPLLRYQFLNNFDKQMNNSEAKYGWLH
APQAYISLKNENDKVIVFERAGLVFVFNFHPTNSFSDYRIGIDVAGTYRVVLNTDSKDVG
GFGRIDEGTRFFTTAMEWNNRKNWTHVYIPCRTALVLALESTISQNP
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcgtcgaaaattcgtccaattccctggaccccaacaataccaatggtgct
gcggatggcattcccaatgatggtacaggtgttgtcaagctcgacccctggctgtcccct
ttcagcgacgctctgaagagacgattttcaaagacccaagattggatcaagaccattaac
gacaatgagggtggtctcgagaagttcagcaggggcaccgaaaagtttggattgaacgtc
gatgccaacaacaacattatctatcgcgaatgggcacccaatgccaccgaggcataccta
attggagacttcaacaactgggatcgtacctcccatcccatgaagaagggaccctttggt
gtcttcgagatcactatcccagccaaggatggtcaggctgccattcctcacaactccaag
atcaagatctccctcactctgcccaatggcgagcgtgccgatcgactccccgcatggatc
aagtacgtgacacaggacctgaatgtgtcgcccgcctatgacgcccgcttctggaacccc
cccgcctccgagacgtacaagtttaagcatgcgcgacccaagaagcccgaaagcgctcgt
gtgtacgaggcccatgttggtatctccagccccgaccagcgggttgcaagctacaaggag
tttacccaaaatatgctacccaggatcaaagatcttggctacaatgtgatccaattgatg
gctgtcatggagcatgcctactacgccagttttgggtatcaggtcaacaacttcttcgcg
gcgagcagtcgatatggccctcccgaggacctcaaggagctcattgacactgcgcatagc
atgggcatcgtcgtactccttgacgtcgtccacagccatgcgtccaagaacgtcctcgat
ggcctcaacgagtttgatggcactgaccaccagtacttccacgggggcggcaagggtcgc
catgatcaatgggatagccgactcttcaattatggccaccatgaggtgatgcgattcctt
ctgagcaacttgcgcttctggatggacgagtaccagtttgatggattccgatttgacgga
gtcactagcatgctttacgtccaccatggcatgggaacgggcttctccggaggttaccac
gagtactttggtgcagatgtcgatgaggaggctgtcgtctatctcatgctggcgaatgag
atgcttcatcttctttacccagatgtcatcaccgttgccgaggatgtttcgggcatgcct
gctctctgtctgccactatcactcggaggcgttggctttgactatcgtctcgccatggcc
attcctgatatgtggatcaagatcctgaaggagctcaaggacgatgactgggacattggc
aacatctgccacaccttgacaaaccgacgtcacggtgagaagacgatcgcatatgccgag
agtcacgaccaagcgcttgttggtgacaagacgctcatgatgcatctctgtgatgccgag
atgtacaccaacatgtcgacattgtcgcctctgaccccagtcattgatcggggtatggca
ctccacaagatgatccgccttctcacacatggcctgggaggtgagggttacctcaacttc
gaaggtaatgagtttggccatcctgagtggcttgacttcccccgagagggcaacaacaac
tcgttctggtatgctcgacgacagctcaaccttacggaggaccctctgttgcgatatcag
ttcctcaacaactttgacaagcagatgaacaacagcgaggccaagtacggatggctccac
gcaccgcaggcgtacatctcactgaagaatgagaatgacaaggtgattgtgtttgagcgt
gccggcctggtattcgtcttcaacttccacccgaccaacagtttcagtgactaccggatc
ggcatcgatgttgctggaacatatagagtagttctcaacacggacagcaaggatgttggc
ggattcggccgcatcgacgagggcacaaggttctttacaaccgccatggaatggaacaac
aggaagaactggacacacgtgtacattccttgccgaactgctctggtcctggcgcttgag
tcgacgatttctcagaacccctag

DBGET integrated database retrieval system