KEGG   Nectria haematococca: NECHADRAFT_63408Help
Entry
NECHADRAFT_63408  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 539 aa AA seqDB search
MSDTASNGNGHPVVPVIVPETTYPESRVLIIGTGGTICMQQGPDGLQPTDNFLENAMAPR
PSFNDRSEPITLPAIRHGEKIQIDSLRTPPTAYERHVRYGIVEFNPLLDSSSISAHDWDA
MASCIQENYHLFDGFVILHGTDSLAYTASALSFMMENLGKPVILTGSQAPIFSLQSDGVD
NLLGSLIIAGTFAIPEVCLFFHHRLYRGNRSAKVSATEFEAFASPNCEPLAKVNGLGVTV
NWPLILRPTTIAKFHITKGLDTTHVACLRVFPGIKPEMIDAVLHLPDLRGLILETFGMGN
IPGGADGRLTQIIKAAVERGLVVVNVSQCVNGFVSPVYAPGTVLGRAGVIFGLDLTAEAA
LTKVSYLLAQPNLSLKDINEKLSRSLRGEMTEIAHQSFSHPDGTLDFAASHLTPKEMAFS
ALGYAIENGELGLVKELLQGEGAQLLKQSDYAGNTAVHLAAVAGSTEILLELLQRGASVH
ERNKANHSPLFVAVKSGKEPCAQLLRVAGAHLAVEERETLPGYVTPQYSQYGQYGGHGF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccgcctctaatggcaatggccaccccgtggtccccgtgatagtcccagag
acaacttatccagagtctcgagtcctcatcattggtacaggaggaaccatctgcatgcag
caaggccctgatggccttcaacccaccgataacttcttggagaatgctatggcccctcga
ccatcattcaatgatagatccgaaccaatcacactccctgctattcgccacggcgaaaag
attcagattgacagtcttcgcactcctccaactgcctatgaacgtcacgtccgctatggc
atcgtcgagttcaaccccctcctggactcaagctccatctcggctcatgactgggacgcc
atggcttcctgcatccaagaaaactaccacctctttgatggcttcgttatcctccacggc
actgattcactggcctacacagcctctgccctctccttcatgatggagaacctcggaaag
cccgtcattctcaccggttcccaggcacccatcttttctcttcagtctgatggcgtcgac
aacctgcttggatcgctcatcattgctggaacctttgccatccccgaagtgtgcctgttc
ttccaccaccgcctctaccgtggcaaccgcagcgccaaggtatctgcgactgaattcgaa
gcctttgccagccccaactgcgagccccttgccaaggtcaacggtctaggtgtcacggta
aactggccccttatcttgcgcccaactacgattgcaaagttccacatcaccaagggctta
gacaccacacacgtcgcctgtttgcgtgtcttccccggcatcaagcctgagatgattgat
gctgtgcttcatctgcctgacctccgtggtctcatccttgagacgtttggcatgggcaac
atccctggcggcgccgacggtcgtcttacacagattatcaaggctgcagttgagcgaggt
ctcgttgtagtcaacgtcagccaatgtgtcaacggtttcgtctctcccgtgtacgcccct
ggtactgtccttggccgggcaggcgtcatctttggcctcgacctcacagctgaggccgcc
ctgacaaaggtttcatacctacttgcacagcccaacctttcgctcaaggacatcaacgag
aaactatcccgatcgttgcgaggcgagatgaccgagatcgcccaccagagcttctcccac
ccagacggtactctcgactttgccgcctctcacctcacgcccaaggagatggcattctct
gccctcgggtacgccattgagaacggcgagcttggccttgtcaaggagcttcttcaggga
gaaggtgcgcagctacttaagcagtctgactatgccggcaacacagcggtgcatctcgca
gctgtggctggtagcaccgagatcctgctggagctcctacagcgcggcgcgagtgtacac
gagcgcaacaaggccaaccactcacctctctttgtggctgtcaagtccggaaaggagccc
tgcgcgcaactactgcgtgtcgcaggtgcacacctcgccgtggaggagagagagacgctc
ccgggctatgtgacacctcagtacagtcagtatgggcaatacggcgggcacggcttctaa

DBGET integrated database retrieval system