KEGG   Nectria haematococca: NECHADRAFT_63972Help
Entry
NECHADRAFT_63972  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
nhe  Nectria haematococca
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NECHADRAFT_63972
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NECHADRAFT_63972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 1486 aa AA seqDB search
MPAAAAHESYSWLGLFGWLIWSIFHIVSTILYWVIRIATINFPSFLYHLFSTSWTVTMNA
TTLMFIMAGLVSAVSWVVRYRILNMYSRLPPEPQRKEPEIDLFPDTHEGGTKSGLANYLD
EFLSAIKIFGYLERPVFHELTRSMQTRKLIAGETINLEEEKGFCIVVDGLVEIFVKSGRS
PRAAAASRGRLDLDSSDEDDVPPGQQTYQLLTEVRNGAPMSSLFSIMSLFTEDVRLRPND
DDDDDVHPAKSSGLRHPSFSKENVSRVPSDAHISMPSSPQEDDMDPEAKKHSGRGTPNLD
NIVNARIPPMSLDGSTPPPGRPPMPTRATSSSAHPDIIARATVDTTIAIIPASAFRRLIK
IYPKATSHIVHVILSRFQRVTLSQAFNYLGLTSEVLQTEKSMIKYTMCQLPNILRGDALE
RLKEKFNRERERTGEGEETKGIALHNSGASRRRRSSTTLRKEAVLQSMTKQRPASVIASN
IVPLRERASPHTPSPGDLLANIQLARGGGRFPPDQRSVSGATMRRQGTNPLDDRFFNDPF
DSRRHARMTIDPRESVDEDNLFRASILECMFKTLGLGSNGSGSREPESMEGSPRLVSLDQ
RRSKNLYSHNNAFGFMGPYDGSADGETESVTSSGMALHAPVNAQVLAHDMRDEVEIVFFP
KGSVLVEQGERNPGLYYVVDGFLDIGTTSDDDPHNILQSNGMGSFQPDPSSPDPSEMGSF
PNLARTEAARDRVESQNQAPAKHRRSVALVKPGGLAGYIGSVSSYRSFIDVVAKTDVYVG
FLPRASLERIVDRYPIVLLTMAKRLTNILPRLILHIDFALEWVQVNAGQVLFHEGDESEA
IYIVLNGRLRLVQDRKGGGVTVRAEFGQGDSVGELEVLTETARPGTLHAIRDTELVKFPR
TLFNSLAQEHPNITIKISKIIASRMRTVIDDTAKFANKDAGAGPSTLMRKSTMNLRTVAI
LPVTAGVPVVEFGNRLMNALAQVGPANGATSLNHAAILNHLGKHAFNRMGKLKLAQYLAD
LEEKYGLVVYVADTNVNSPWTQTCITQADSILLVGLAEGSPAIGEYERFMLGMKSTARKL
LVLLHAERYSRPGLTRSWLQNRMWINGGHYHIQMAFRTNEMPVHPPSKRLGQALKERVQV
LQAEIQKYTSRKVHHTPYYSPDTTFKGDFHRLARRLCGKSIGLVLGGGGARGITQIGIIR
AMEEAGIPIDLVGGTSIGAFVGALYARHADVVPMFGFAKKFAGRMASLWRFALDLTYPSA
SYTTGHEFNRGIFKAFGDTQIEDFWLEYYCNTTNISKSRAEFHTSGYAWRYIRASMSLAG
LLPPLCDEGSMLLDGGYVDNLTVSHMKGLGVDIIFAIDVGALDDDTPQTYGDSLSGAWAF
VNRWNPFSSHPNPPTLAEIQARLAYVSSVDALERAKAMAGCIYMRPPIDDYGTLDFHKFD
ELSSLGYKYGQEFLQKMRDQGVLPLVEETEAKKALRRTMAPRRASI
NT seq 4461 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcagccgcccatgagtcctacagttggctaggcctctttggatggctgatc
tggtccatcttccacatcgtctcgaccatcctctactgggtgatccggatcgcaacgatt
aattttccttccttcctgtaccacttgttctctacaagctggacagtcaccatgaacgcg
actacgctcatgttcatcatggcgggcctcgtctcggcggtgagctgggtcgtcaggtat
cgcatcctcaacatgtactcgcgtctgcctcccgagccgcaacgcaaggagccagagatc
gacctatttccggatacccacgaaggtggcaccaagtcgggtttggccaattacttagac
gagttcttgagtgccatcaagatctttggttaccttgagcgaccagtcttccacgagttg
actaggagcatgcaaacgaggaaactcattgccggcgaaaccatcaacctggaagaggag
aagggcttctgcatcgtcgtcgacggactggttgagatttttgtcaagtcgggtcgaagt
cctcgtgcagctgccgcgtctagaggacgtcttgacctagactcttctgatgaagatgat
gtccctcctggtcagcagacctaccaacttcttacagaagttcgcaatggtgccccaatg
tcatcgctcttctctatcatgtctctgttcacagaggatgttagactacgtccaaacgat
gacgacgacgacgatgtgcatcctgcaaagagcagtgggctgagacacccaagcttctcg
aaggagaatgtgtctcgtgtcccatcggatgcccacatctccatgccgagctcccctcag
gaggatgacatggatcccgaggcaaagaagcacagtgggcgcggtactcccaacctggac
aacattgtcaacgccagaataccacccatgtctctggacgggtctactccccctcctgga
agaccacctatgcctacaagggcaacctcgagctcagctcacccagacatcatcgctcgg
gcgactgttgatacaaccatcgcgattattcctgcaagcgcttttcggaggcttatcaag
atctacccaaaggccacttcgcatattgttcatgtcattctctcgagattccagagagtc
actctctcccaagccttcaactacctgggtctcaccagtgaagtgctgcagacggagaag
agcatgatcaagtacacaatgtgtcagctccccaacattttgcggggtgatgctctggaa
cggttgaaggaaaaattcaatcgcgaacgggaacgcacaggagagggagaggagaccaag
ggcatcgctctacacaattctggtgcatctcgccgacgaaggtctagtacgactcttcga
aaggaggctgtactacagtcgatgacgaagcaacgaccggcttcggtcattgctagtaac
attgtcccgcttcgtgaacgggcttcaccccatacaccgagtcctggtgacctattggcg
aatattcaactcgcccgtggtggcggccgtttccctcctgatcagcgatcagtttcgggt
gcgacaatgagacggcaagggaccaaccccttggatgaccgattcttcaatgatccgttt
gactcgagaagacatgctcgcatgactattgatccgcgagagtcagttgacgaggacaat
ctcttccgagcttctattctggagtgcatgttcaagacgcttggtttgggctcaaacgga
agtggatctcgagaaccggaatcgatggagggctctcccaggcttgtctcgctggaccaa
cgccgatcaaagaacttgtactctcacaacaatgcctttggattcatgggcccttatgat
ggttctgcggacggggaaaccgagtcggtgacatctagcgggatggctcttcatgcgcca
gtcaacgctcaagtcctggctcacgacatgagagacgaggttgaaattgtcttcttcccc
aaaggctccgttctcgtggagcaaggggagagaaatccgggcctttactatgttgttgat
ggtttcttggatattggtacaaccagtgatgacgacccacacaacatcttgcagtccaac
ggcatgggctcattccagccggacccctcgtcgccagatccatccgagatgggatcattc
cccaatctagcgaggacggaggctgcacgagaccgagttgaaagccagaatcaagctcca
gcaaagcaccgtcggagcgttgctctcgtcaagcccggtggcctggctggctacattgga
agcgtgtcctcatacaggtccttcatcgatgtcgttgcgaagaccgatgtgtatgttggg
ttcctcccccgtgcttctctggagcgaatcgtggatcggtatccaatcgttcttttgacg
atggccaagagactgacaaacattttgccacgtctcatcctgcatatcgactttgctctg
gaatgggttcaagtcaatgcgggacaagtcctcttccatgaaggagacgaaagtgaagcc
atttacatcgtcctcaatggccgccttcgtcttgttcaagatcgaaagggcggcggagtg
actgtccgggctgaatttggacagggagatagtgttggcgagctcgaggtgctcacggaa
actgctcgtcctgggactctgcacgccatccgagacacggagctggtgaaattcccccga
accctgttcaacagcctggcgcaggagcatccaaacatcaccatcaagatttccaagatc
attgcgtcccggatgaggacagtgattgatgacacagccaagttcgccaacaaggatgct
ggtgccggaccgagcacgttgatgcgcaagtcgacgatgaaccttcgcacagttgccatc
ttgcccgtgacagcgggcgtgccagttgtcgagttcgggaaccgcctgatgaacgccctc
gcacaggttggccctgcaaacggagccacgtctctgaaccatgccgccattctcaaccac
ctgggcaagcatgccttcaacaggatgggcaagctgaagctcgcccaatatctcgcagac
ctggaagagaagtacggtctggttgtctatgtcgcagataccaatgtcaactcgccgtgg
acccagacttgcatcactcaagctgacagcatcttgcttgttggacttgctgagggttcc
ccagccattggcgagtatgagcgcttcatgcttggaatgaagtctacggcccgaaaattg
ctagtattgctgcacgctgagcgatactcgcgtcctggcctgaccaggtcttggcttcaa
aaccgcatgtggatcaatggtggccactaccacatccagatggccttcaggacaaatgag
atgcctgtgcatcctccttccaagaggttgggtcaggcactcaaggaacgtgtccaggtg
ttgcaggcggaaattcaaaagtacacctctagaaaggtgcaccacacgccatactactcc
ccggacacgaccttcaagggcgactttcatcgattggctcggcgactctgcggcaagtct
attggacttgtgcttggcggaggcggcgcacgaggaatcacacagattggcatcatcaga
gccatggaagaagctggtatccccattgatttggttggtggtacttcgattggtgccttt
gtcggagctctgtatgcacgacatgcagacgtggtgcccatgtttggatttgccaagaag
tttgctgggcgcatggccagtctctggcggttcgctctggatcttacctatccgtcagca
tcctacacgacagggcacgagttcaatcgtggtatcttcaaggcatttggcgacacgcag
attgaagacttttggcttgaatactactgcaacacgaccaacatcagtaagagcagggcc
gagttccacacaagcggatacgcatggaggtatatccgagcgtccatgtctctggcgggc
ttacttcccccgttgtgtgatgaaggcagcatgctgcttgatggtggttatgttgacaac
ctgactgtttcacacatgaaaggtctgggagtggacattatctttgctatcgacgttgga
gcactggatgatgacacgccacagacgtatggagactccctttctggagcatgggcattt
gtcaaccgatggaatccattctcgtcacaccccaaccctccaaccttggcagagattcag
gcgcggctagcgtatgtctcaagcgtggatgccctggagcgagccaaggcgatggcagga
tgcatctacatgcgaccaccgatcgatgactacgggaccctcgatttccacaagtttgac
gaactgtcttcattgggatacaagtatggacaagagtttttgcagaagatgagggatcag
ggagttttgccattggtagaagaaacggaagccaagaaggcattgagacggactatggca
cctagacgagcgagtatttga

DBGET integrated database retrieval system