KEGG   Nectria haematococca: NECHADRAFT_65446Help
Entry
NECHADRAFT_65446  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
nhe  Nectria haematococca
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NECHADRAFT_65446
Enzymes [BR:nhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NECHADRAFT_65446
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NECHADRAFT_65446
  Exosomal proteins of colorectal cancer cells
   NECHADRAFT_65446
  Exosomal proteins of bladder cancer cells
   NECHADRAFT_65446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 1071 aa AA seqDB search
MTNQDIENKPAVGVPYFTPAQEPPAGTPLDPASAPTVFKPLRIRGIELHNRFGVSPMCTY
SAQDGKLTDWHLVHLGQFALKGAGLVFVEATGVEPRGRISPNDSGLWDDEQIAPLKRITD
YIHSQNSRAAIQLAHAGRKASTLAPWIGGTATKTLAPESVGGWPEDVVGPSAVPFADDHA
TPNELTVDQIKELVQKWQDAAVRAVKAGFDVIEIHGAHGYLITNFLSPVSNKRTDQYGGS
FENRTRFLFEIIEAVRAVIPSEMPLWLRISATEWMEWSGEPSWDLESSIRLAKLLPAAGI
DVLDVSSGGNASAQKIKVHQTFQSDLAGKIREALRADGKELLIATVGLVADGAFARSVVQ
EDEKPQADFVLVARQFLREPDFVLSAAQQLGVEVKWPNQYHRAGPKPRGRSLQASQHLGV
KVQVGWAGPLPGGAGSLIGQSCPVEAPQPAERPTSPPAGGAHGAVLPTAGAQGRSGWYCP
RCLVLMINPIQPPKGTLVQLSPSIHPFIAPQPTSHVPRPQPSRTTSTKLSASIFSTRTSP
PPFPSSPHIIDLSLARLPAKPFFTAIMYHKRIACGFMAALAAYASAADSDVHQLTQDTFD
EFIKSNDLVLAEFFAPWCGHCKALAPEYEEAATTLKEKNIKLAKVDCTEEADLCKNFGVE
GYPTLKVFRGLDNITPYSGQRKAAGITSYMIKQSLPAVSILTKDTLEEFKTADKVVVIAY
LSADDKASNETFSKIAEGLRDTYLFGGVNDAAVAEAEGVKAPAVVVYKAFDEGKNTFTEK
FEAEAIESFISTSATPLIGEVGPETYAGYMSAGIPLAYIFSETAEERKELGDAIKPIAEK
YKGKINFATIDAKAFGAHAGNLNLKTDKFPSFAIQEIAKNQKFPFDQEKEITHDSIAKFV
EDFSEGKIEPSIKSEPIPETQEGPVTVVVAKSYNDIVLDDTKDVLIEFYAPWCGHCKALA
PKYDELASQFAASEFKDKVVIAKVDATQNDVPDEIQGFPTIKLYPAGAKDAPVTYQGSRT
VEDLAEFIKENGKYKAEVSAKEEGTEEAAPAASEEKKEAEKEKEADGHDEL
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccaagacatcgagaacaagcccgctgttggggttccttacttcaccccagct
caggagcccccggccggtaccccgcttgatccggcttcggccccgacagttttcaagccc
ctccggatccgtggcattgagctccataaccgcttcggagtgtctcccatgtgcacctac
tcggctcaggatggaaagctgaccgactggcatctcgtccacctaggccaattcgccctg
aagggtgccggccttgtctttgttgaagccaccggcgttgagccccgaggccgcatcagc
cctaacgactctggcctctgggacgacgagcaaattgcccctctcaagcgcattacagac
tacatccacagtcagaactcgcgagcggctattcaactcgctcatgccggccgcaaggca
agcacacttgctccctggatcggcggcactgctacaaagacgcttgcacctgagagcgtg
ggaggctggcctgaggatgtcgttggaccaagtgcggtcccttttgcggacgaccatgcc
acgccgaacgagttgacggtggaccagatcaaggagctcgtgcagaagtggcaggatgct
gctgtgagagccgtcaaggcgggctttgatgtcatcgagattcatggtgcccatggatac
ttgatcaccaactttctctcgcccgtttccaacaaacgaacagatcagtatggtggtagc
ttcgagaaccgaacccgcttcctcttcgagatcatcgaggccgttcgcgccgtgatcccc
tccgagatgcccctctggctgcgcatttcggccaccgagtggatggagtggagcggagag
ccctcatgggaccttgagagcagcatccgcctggccaagctgctcccagccgccggcatt
gacgtcctcgacgtgagcagcggcggcaacgcctcggcccagaagatcaaggttcaccag
accttccagtcggacctggcaggcaagatccgcgaggccctccgcgccgacggaaaggag
ctactcatcgcgacagtgggcctcgtcgccgacggtgcctttgcccggtccgtcgtccag
gaggacgagaagccccaggccgactttgtcctcgtggccaggcagttcctccgggagccc
gactttgtgctcagcgccgcgcagcagctgggtgtcgaggtcaagtggccgaaccagtac
caccgggcaggacccaagccccgtggacggtccctacaagcatcgcagcacctgggggtg
aaggtgcaggtggggtgggcaggtccccttccaggcggtgcagggtccctcataggccag
agctgccctgtggaagcgccacaacccgctgaaagacccactagcccgcccgctggaggg
gcccatggggccgtgctgccaactgcaggtgctcagggcaggtccggctggtactgcccg
cgctgcctggtcttgatgatcaatccaatccagcctccaaaggggacacttgttcaattg
agcccctccatccatccattcatcgccccccagcccacctctcatgtacccagaccccag
cccagccgcactacaagtacaaaactctccgcctccatcttctctactcgaacatctcct
cctcctttcccttcctccccccatatcattgacctttcccttgcccgtctcccagcgaag
cccttctttacggccatcatgtatcacaagcgcatcgcctgcggcttcatggcggctctg
gctgcctatgcctccgccgccgactcggatgtccaccagctcacccaggacacctttgac
gagttcatcaagtccaacgacctcgtccttgccgagttcttcgctccctggtgcggccac
tgcaaggccctcgcccccgagtacgaggaggctgccactaccctcaaggagaagaacatc
aagcttgccaaggttgactgcactgaggaggccgacctctgcaagaactttggcgtcgag
ggttaccccaccctcaaggtcttccgtggccttgacaacatcactccctacagcggtcag
cgcaaggctgctggcatcacctcctacatgatcaagcagtccctccccgctgtctccatc
ctcaccaaggacaccctcgaggagttcaagactgccgacaaggtcgtcgtcatcgcctac
ctcagcgccgacgacaaggcctccaacgagaccttctccaagatcgctgagggtctccgc
gacacctacctcttcggtggcgtcaacgacgccgctgttgctgaggctgagggcgtcaag
gcccccgccgttgtcgtctacaaggccttcgatgagggcaagaacaccttcaccgagaag
ttcgaggctgaggccatcgagtccttcatctccacctccgccacccctctcattggcgag
gttggccccgagacctacgccggctacatgtctgctggtatccccctggcctacatcttc
tccgagaccgctgaggagcgcaaggagctcggtgacgccatcaagcccattgctgagaag
tacaagggcaagatcaactttgccaccatcgatgccaaggctttcggtgcccacgctggc
aacctgaacctcaagaccgacaagttcccctctttcgccatccaggagattgccaagaac
cagaagttcccctttgaccaggagaaggagatcacccacgacagcatcgccaagttcgtt
gaggacttctctgagggcaagattgagcctagcatcaagtctgagcccatccccgagacc
caggagggtcccgtcaccgtcgtcgtcgccaagagctacaacgacatcgtcctcgacgac
accaaggatgtcctgattgagttctacgctccctggtgcggtcactgcaaggctctcgcc
cccaagtacgacgagcttgcttcccagttcgctgcctctgagttcaaggacaaggttgtc
atcgccaaggttgatgccacccagaacgacgttcccgatgagatccagggcttccccacc
atcaagctgtaccccgctggtgccaaggacgctcccgtcacctaccagggctcccgcact
gttgaggacctcgccgagttcatcaaggagaacggcaagtacaaggctgaggtctccgcc
aaggaggagggtactgaggaggctgcccccgccgccagtgaggagaagaaggaggctgag
aaggagaaggaggccgacggccatgatgagctgtaa

DBGET integrated database retrieval system