KEGG   Nectria haematococca: NECHADRAFT_65653Help
Entry
NECHADRAFT_65653  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nhe  Nectria haematococca
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NECHADRAFT_65653
   00052 Galactose metabolism
    NECHADRAFT_65653
   00500 Starch and sucrose metabolism
    NECHADRAFT_65653
   00520 Amino sugar and nucleotide sugar metabolism
    NECHADRAFT_65653
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NECHADRAFT_65653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 514 aa AA seqDB search
MASAIKSALPTHLKPHGGSDDQLFERRHGKTRSHMAFENTSTNVAAAQMRNALTNLAESL
FDTEMDNFFALFRRYLNDKAKGNAVDWDRIAPPAQGQVVDYEDLANTESVQFLNKLAVLK
LNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEFLNRTYDVNVPFILMNSFNTNDDTA
AIIKKYEGHNVDILTFNQSRYPRIYKDSLLPVPKSFDSSINEWYPPGHGDVFESLYNSGI
LDKLLERGIEIIFLSNVDNLGAVVDLRILQHMMETNAEYIMELTNKTKADVKGGTIIDYE
GSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLKAIKRVVENDELEMEIIPNGKTI
PGDKKGESDISIIQLETAVGAAIRHFNNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLKH
GQLQMSAARFGDAPLIKLGGDFKKVSDFQKRIPSIPKVLELDHLTITGAVNLGRGVTLKG
TVIIVATEGSTIDIPPGSILENVVVQGSLRLLEH
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgcaatcaagagcgcgctgcctacccacctgaagcctcacggtggcagtgat
gatcagctctttgagcgccgtcatggcaagacgcgcagtcacatggctttcgagaacacc
tcgaccaacgtcgctgccgctcagatgcgaaatgctctgaccaacctcgccgagagcctg
ttcgataccgagatggacaacttcttcgccctcttccgacggtaccttaacgacaaggcc
aagggcaacgccgttgactgggaccgcattgctcctcccgcccagggccaggtcgtcgac
tacgaggaccttgccaacaccgagtcggtccagttcctgaacaagctggccgtcctcaag
ctcaacggtggtctcggtacctcgatgggttgcgttggtcccaagtcggtcatcgaggtc
cgtgacggcatgtccttcctcgacctttccgtgcgacagatcgagttccttaaccgcacc
tacgacgtcaacgtgccttttatcctgatgaactcgttcaacaccaacgacgacaccgcc
gccatcatcaagaagtacgagggccataacgtggatatcctcaccttcaaccagtcccga
tacccccgaatctacaaggactctctgctccccgtccccaagagctttgattcctccatc
aacgagtggtacccccctggccatggtgacgtcttcgagtctctgtacaactcgggcatc
ctcgacaagctcctggagcgaggcatcgagatcatcttcctgtctaacgtggacaacctg
ggcgccgttgtcgatctccgcattctccagcacatgatggagaccaacgccgagtacatc
atggagctgaccaacaagaccaaggctgatgtcaagggtggtactatcatcgattacgag
ggctcggtccgtctgctggaaatcgcccaggtccccaaggagcacgtcaacgagttcaag
tcgatcaagaagttcaagtacttcaacaccaacaacatctggctcaacctcaaggccatc
aagcgtgttgtggagaacgacgagctcgagatggagatcatccccaacggcaagaccatc
cccggtgacaagaagggcgagtcggacatttccatcatccagctcgagacggccgtcggt
gctgccatccgccacttcaacaacgcccacggtgtcaacgtgccccgtagacgattcttg
cccgtcaagacctgctctgacctgatgctggtcaagtcggacctctacaccctcaagcac
ggccagcttcagatgagcgcggcccgcttcggtgacgcccccctgatcaagctgggtggc
gacttcaagaaggtctcggacttccagaagcgaatcccctccatccctaaggtgctggag
ctggatcacctcaccatcactggtgccgtcaacctcggccgcggcgtgacactcaagggc
accgtcatcatcgtcgcaacagagggcagcaccatcgacatcccccccggttccatcctc
gagaacgtcgtcgtccagggcagcttgcgtcttctggagcactga

DBGET integrated database retrieval system