KEGG   Nectria haematococca: NECHADRAFT_66476Help
Entry
NECHADRAFT_66476  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NECHADRAFT_66476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 692 aa AA seqDB search
MAELDTLDVIVLGAILLGTLAYFTKGKVWGVTKDPYANGFAAGAAARPGRTRNIVEKMEE
SGKNCVVFYGSQTGTAEDYASRLAKEGKSRFGLDTMVADLEEYDFDNLDTIPSDKVVMFV
LATYGEGEPTDNAVDFYEFITGEDASFTEDNDPPLGNLNYVAFGLGNNTYEHYNSMVRNV
NKALEKLGAHRIGEAGEGDDGAGTMEEDFLAWKDPMWEALSKKLGLEEREAVYEPTFAIT
ERDDLTPESTEVYLGEPNKMHLEGTAKGPFNTHNPYIAPIAESRELFSAKDRNCLHMEVD
ISGSNLRYETGDHIAVWPTNPGEEVARFLDILDLSAKQHEVVNVKSLEPTAKVPFPNPTT
YDAILRYHLEICAPVSRQFVSTLAAFAPNDEIKAEMNRLGNDKDYFHEKTGPHYYNIARF
LAAVSKGEKWTNIPFSAFIEGITKLQPRYYSISSSSLVQPKKISITAVVESQMIPGRGDP
FRGVATNYLLALKQKQNGDDNPTPFGQSYEIMGPRNKYDGIHVPVHVRHSNFKLPSDPGK
PVIMIGPGTGVAPFRAFVQERAKQARDGIEVGKTLLFFGCRKPTEDFMYESEWEEYKEAL
GDKFELITAFSRQSSKKVYVQHRLKERSKEVSDLLSQKAYFYVCGDAANMAREVNTVLAQ
ILAEGRGVSEAKGEEIVKNMRAANQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcgacactctggacgttatcgtcctcggcgccatcttgctcggaaccctc
gcatactttaccaaaggcaaggtatggggcgtcaccaaggacccctacgccaacggcttc
gctgctggcgccgcagcgaggcctggacgcacaaggaacatcgttgagaagatggaggag
tccggcaaaaactgcgtcgtcttctacggctcccaaactggtaccgccgaggactatgct
tctcgtctcgccaaggaaggcaagagccgatttggtctcgatactatggtcgccgatctt
gaagaatacgattttgacaaccttgacactattcccagcgacaaagtcgtcatgttcgtc
ctcgctacctacggtgagggagagcccaccgataacgctgtcgacttctacgaattcatc
accggcgaggacgccagcttcaccgaggacaacgatcctcctctgggcaacctcaactac
gtcgctttcggtctcggcaacaacacctacgagcactacaactcgatggttcgcaacgtc
aacaaggctcttgagaagctcggcgctcaccgcatcggcgaagctggtgagggtgacgac
ggcgctggcaccatggaagaggactttctggcctggaaggaccccatgtgggaggctctg
tctaagaagcttggcctcgaggagcgtgaggccgtttacgagcctacctttgctatcacc
gaacgcgacgacctgacccccgaatccaccgaagtctatctcggcgaacccaacaagatg
cacctcgaaggcactgccaagggacctttcaacacccacaacccctacattgcgcctatt
gccgagtctcgggaattgttctccgccaaggaccgaaactgtctccacatggaagtcgac
atcagcggttcaaacctcaggtacgagactggagatcacattgctgtctggcccaccaac
cctggcgaggaggtcgcccgcttcctcgatatcctcgatttgtccgcgaagcagcacgaa
gttgtcaatgtcaagtctctggaacccaccgccaaggtccccttccccaaccctacaacc
tacgatgctatcctccggtaccatctcgagatctgtgctcctgtttcccgtcaatttgtt
tctaccctagccgcctttgctcccaacgatgagatcaaagctgagatgaaccggcttggt
aacgacaaggattatttccatgagaagaccggtccccattactacaacatcgcgcgtttc
ctggctgctgttagcaagggcgagaagtggactaacatccccttctctgccttcatcgaa
ggtattaccaagctccagcctcgttactactccatctcgtcctcgtctctggttcagcct
aagaagatttccatcactgctgttgttgagtcccagatgattcctggacgtggcgatcct
ttccgcggcgttgccaccaactatctcctggccctgaagcagaagcagaatggcgacgac
aaccctacgccctttggtcagagctacgaaatcatgggtccccgcaacaagtatgatggt
attcacgttcctgtccacgttcgtcactccaacttcaagctgccctcggaccctggtaag
cccgttatcatgattggccccggaactggtgttgcccctttccgcgctttcgttcaggaa
cgtgccaagcaggctcgagatggaatcgaagttggcaagactctcttgttctttggatgc
cgcaagcctactgaggatttcatgtatgagtctgagtgggaggagtacaaggaggctctc
ggcgacaagttcgaactcatcactgccttttcccgccaatcttccaagaaggtgtacgtg
caacaccgacttaaggagcgatcaaaggaggtcagcgatctactgtcccagaaggcctac
ttctatgtttgcggtgatgctgcaaacatggcgcgtgaggtcaacactgtcttggcgcag
atcctggctgagggacgtggcgtttccgaggccaagggtgaggagattgtgaagaacatg
agggcggcgaaccaataccaggaggatgtctggtcatga

DBGET integrated database retrieval system