KEGG   Nectria haematococca: NECHADRAFT_67443Help
Entry
NECHADRAFT_67443  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nhe  Nectria haematococca
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:nhe01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nhe00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:nhe00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 542 aa AA seqDB search
MASTDSILQGVSVLGKVDDVHRKILTPEALAFLALLHRSFNDRRKALLERRKVRQAELDR
GVLPDFLPETKHIRENPTWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVYTYMADFE
DSSAPTWDNMINGQVNLYDANRRQVDFKQGPKEYKLRTDRKLPTLIVRPRGWHLEEKHLT
VDGEPISGSLFDFGLYFFHNAIETQRQGFGPYFYLPKMESHLEARLWNDAFNLAQDYIGI
PRGIIRGTVLIETILAAFEMDEIIYELRDHSSGLNCGRWDYIFSVIKKFRNNANFVLPDR
SAVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKNDPAANDKAMEGVRADKLREV
RAGHDGTWVAHPALASIATEIFNKHMPTPNQHFVRREDVTIGQNDLLNMNVPGTITEEGI
KKNLHIGLGYMEAWIRGVGCVPINFLMEDAATAEVSRSQLWQWVKHGVTTAEGKRVDKAY
ALKLLKESADQLAAAGPKGNKFHLAAQYFSGQVTGEDYADFLTTLLYNEITQAGPPSPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaccgactccatcctccagggcgtctccgtcctcggcaaggtcgacgatgtc
caccgcaagatcctcacccccgaggccctcgccttcctcgccctcctgcaccgctccttc
aacgaccgacgcaaggccctcctcgagcgccgcaaggtccgccaggccgagcttgaccgg
ggcgttctgcccgacttcctccccgagaccaagcacatccgtgagaaccccacatggaag
ggagctcccccggccccgggtctggtcgaccgccgcgtcgagatcaccggccccaccgac
cgcaagatggtcgttaacgccctgaacgccgacgtctacacttacatggccgatttcgag
gattccagcgcccccacatgggacaacatgatcaacggccaggtcaacctctacgatgcc
aaccgtcgtcaggtcgactttaagcagggccccaaggagtacaagctccgaactgaccgc
aagctccctaccctcattgtccgtccccgtggctggcacctcgaggagaagcatctcacc
gttgatggcgagcccatctctggttccctcttcgactttggtctctacttcttccacaat
gctatcgagacccagcgccagggcttcggtccttacttctacctccccaagatggagagc
cacctcgaggctcgtctctggaacgacgccttcaaccttgcccaggactacattggcatc
ccccgcggcatcatccgtggtaccgtcctgatcgagaccatccttgccgcctttgagatg
gacgagatcatctacgagctccgcgaccacagctctggtctcaactgtggccgatgggac
tacatcttcagcgtcatcaagaagttccgcaacaacgccaacttcgtcctccctgaccga
tccgccgtcaccatgactgttcccttcatggacgcctacgtcaagctcctcatccagacc
tgccataagcgtggtgtccacgccatgggtggcatggctgctcagatccccatcaagaac
gaccctgccgccaacgacaaggccatggagggtgtccgcgccgacaagctccgtgaggtc
cgcgctggccacgacggtacctgggttgcccaccccgctctcgccagcatcgccaccgag
atcttcaacaagcacatgcctactcctaaccagcacttcgtgcgacgtgaggatgtcacc
attggccagaacgatctgctcaacatgaacgttcccggtaccatcaccgaggagggtatc
aagaagaacctccacatcggtcttggctacatggaggcctggatccgaggtgtcggctgt
gtccccatcaacttcctcatggaggacgctgctaccgccgaggtctcccgaagccagctt
tggcaatgggtcaagcacggcgtcaccaccgccgagggcaagcgtgtcgacaaggcttac
gccctgaagctgctcaaggagtctgccgaccagctcgctgccgccggtcccaagggcaac
aagttccacctcgctgctcagtacttctctggccaggtcactggcgaggactacgccgac
ttcctcactactctcctctacaacgagatcacccaggctggtccccccagccctgcttcc
aagctgtaa

DBGET integrated database retrieval system