KEGG   Nectria haematococca: NECHADRAFT_67500Help
Entry
NECHADRAFT_67500  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nhe  Nectria haematococca
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nhe00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 599 aa AA seqDB search
MQFTTVDASPQLVPSKRDPLVPIHSHSVEEREAKRPRTAEVLLEEQLPQSLIDAVELTKE
TIKAEEEELLPQGITETEEEKQKHWFVGSIDQGTTSTRFLIFNGHGEPVASHQIEFENHY
PHSGWHEHKPMELLESVETCIAKATEKFCADGHTASEIHSIGITNQRETTVLWDKNTGEP
LYNAVVWPDTRTAALVRDLKARPGADKLQEKCGLPLSTYPSSVKLLWVLQNVDSVRKAYD
EGRLAFGTVDSWLIYQLNGGAKKEGGPVYVTDSTNASRTMFMNLKTLDYDDDLLKFFNID
RNKLGLPKIVPSSHPTAFGALARGPLKGTPIAGCLGDQSSALVGQCGFSPGQAKNTYGTG
CFLLYNVGHEPVISKTGLLATVAYDFGRGRKPVYALEGSIAVAGSGVKFLQNNLGIIKAA
SEVDGVAQSVPDNGGVVFVTAFSGLFAPYWIDDAKGTLFGVTQHTKKGHIVRATLEATCH
QTAAILDAMASDSGHALDILAVDGGLSNSDLCMQTQADLSGVPVDRPAMRETTALGAAIA
AGLATGVWNELEELHEVNRKGRKVFKPQLDIKDRNRMRKRWERAVDMSKGWLKDDDDDE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcacaacagtcgacgcgtcacctcaactggtgcccagcaaacgggaccccttg
gtccccatccactcacactcggttgaggagcgtgaggctaagcgtccacgaactgccgag
gtcttgctcgaagaacaacttcctcaatcgctcatcgacgcggttgaacttaccaaagag
actatcaaggcagaagaggaagaactgcttcctcaaggaattaccgagacggaggaggag
aagcagaagcattggttcgttggtagtatcgatcagggaacgacttcaactcggttcctc
atcttcaatggccacggcgagcctgttgccagccaccagatcgagtttgagaaccactac
ccacactcgggatggcacgagcataagccaatggaactcctcgagtctgtcgaaacatgc
atcgcaaaggcgaccgagaagttctgcgcagatggccacactgcctctgaaatccactcc
attggcatcaccaaccagcgcgagacgacggtcctttgggacaaaaacaccggcgaaccc
ctctacaatgccgtcgtctggcctgacactcgtactgccgcgcttgtgcgcgatcttaag
gcccgacccggtgccgacaaactccaggagaagtgcggactcccattgtccacatacccc
tcaagcgtcaagttgctttgggttctccaaaacgtagactccgtgcgaaaggcctatgac
gagggccgcctcgcattcggcactgttgactcatggttaatctaccaactcaacggaggt
gccaaaaaggagggtggacctgtctacgtcacagactcgaccaacgccagccgtaccatg
ttcatgaacctcaaaacacttgattacgacgatgatctgctcaagtttttcaacatcgac
cgtaacaagcttggtcttcctaagatcgtgccatcctcccatcccactgcctttggtgcc
ctcgcccgcgggcccctgaagggcacacccattgctggctgcttgggtgatcaatcatct
gctctggtgggccaatgcggtttcagcccaggtcaagccaagaacacatatggcacgggc
tgcttcctcctctacaatgttggacacgaacctgttatctccaagacgggtctgctcgca
accgtcgcctacgactttggtcggggccgtaagccagtctacgctctcgagggtagcatc
gctgttgctggttccggtgtcaagtttctacaaaacaacctgggcatcatcaaggcggct
tcagaggtggacggtgtcgctcagtccgtccccgacaatggtggtgtcgtctttgtgacg
gcgttcagcggtctctttgccccgtactggattgacgatgccaagggcacgctctttggt
gtcacccagcacacaaagaaggggcacattgtgcgagccacactcgaggctacctgccac
caaacggcggcgattcttgacgccatggcctcggattctggccatgccctggacatcctt
gcagtagatggaggtctatccaactcggatctctgtatgcaaactcaagctgacctgagc
ggtgtccctgttgatcgcccagccatgcgcgaaactaccgcactgggggccgccattgct
gccggactcgccactggagtctggaacgagcttgaggaactacacgaagtgaacaggaag
ggccgcaaagttttcaagcctcagctcgatatcaaggaccgaaatcgtatgcggaagcgg
tgggagcgggctgtcgacatgagcaaaggatggctcaaggatgacgacgatgatgaataa

DBGET integrated database retrieval system