KEGG   Nectria haematococca: NECHADRAFT_67504Help
Entry
NECHADRAFT_67504  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
nhe  Nectria haematococca
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:nhe04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 1054 aa AA seqDB search
MASLGHSRASSVATAGTHTMANGGAFGHPSGPGGRRGGDAPAASSIPHIDDILANPRNID
ENQSIRKLLEAAQASLRQAEMARDFRRPAIALQEYLRASVIAIQIIGAHRDYSSMQSDHK
DLARAHTAFLNQLRQQDPFYAKLKQDIIADNKRTGVQPKIGRPGLSQGGSRPQSPSKPAV
DRSIPPLNQQVNGSPRSSISGPVARSKPVIQPKPQALHGNAIKPPQRSNTAQDLAARFAN
LRGPQSSPGQDPRIKTHQITLPKPMGPREMPPPRPPKVELDTNVPTLPKMPDAIYSPARG
SISGEVSRPPMSTPRGVYSRTTSSASIPGTPTASSQSQPDYFSPPTQSYSNNIIPPVPPG
NAIKIPEGESITPEELYQAMKAKGTILIIDVRVRQEFNEGHIMSSSTICVEPSILLRESP
SADQISESLIISPNQEQSLFEQRDKYDLVVFYDQDSEEIPKHPRNSDDLVIVSLHRALVH
FNYPKDLRNPPKILKGGLDAWVDLMGAASLQSNEPGPSKPVQLQRSRNRATAIERRRSKY
IVKPLRPDEVKAWQETLKNDDMQTASSPNFTRTTEDFLRRFPPVSLEQESMVAPEKPQHR
PGYGLSHKVDLYTDLPSPPTRPAPALPRPSYSGLTEGRDESELYGNNNTPAPGRLVRVPS
AKPMEQQSTGDTNKFYTGLNNPHNWCYANSTLQSLLASPEFGRELSNSGWVERYHAPRKD
DEKIDHPQLMIRIISNLFHWMSSGKFQVMKAQTLMDYSRHICDQGRSIEQFGGKQQQDAQ
EFMSFLLTHLHDETNTRRDRKGQAAQPDTTKQSLLQAAADYWHNHLEYNRSIVDRYWRGL
ELSTVECFECHTRTYQFTPFDWIPVTVGMGRGMTLEQVLDQHTAGNTLDDFSCDRCRRPT
RALQSLSLARLPSLLCVVFRRFHYQQATSDLRKSTAPITWDFNDTDFTRYFLPPADRAAC
SGVEPTDPAFTGPFRYEAYAVIVHTGSRIDNGHYLAYVRDSSSHDPYAWYCCNDSRVTKV
RIGHGGSDDAQEEVFKSGRDRVPYLVFFRRKGMR
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgctgggccattcgcgcgcgagcagcgtagccaccgccggcacacacaccatg
gccaacggaggcgcatttggccacccctctggcccaggaggccgtcgtggaggggacgca
cctgctgcttcatcaattccgcatatcgacgacatcctcgccaacccgcgaaacattgat
gagaatcagtccatccggaagctgctcgaggcggctcaggcgtcgttgcgccaggctgag
atggcccgcgactttcggagaccggccatcgccctccaggagtacctccgagcgtccgtc
attgctattcagatcattggagcccatcgagattattcgtctatgcagagcgaccacaag
gatctcgcccgtgctcataccgccttcctcaaccagcttcgtcaacaagatcccttctac
gccaagcttaagcaggatatcatcgcggacaacaagagaaccggcgtgcagcccaagatt
ggtcgacctggcttgtctcaagggggcagccggccccaatccccctccaagccagcggtt
gatagatcaatacctccactgaatcaacaagtcaatggatctccccggtccagcatcagt
ggtcctgtagctcggtcgaaaccagttattcaaccaaaaccccaagcccttcatggaaac
gcaatcaagccacctcaaaggagcaatacagcacaagatcttgccgcccggtttgccaac
ctgagaggaccgcagtcttcaccaggacaggatcctcgcataaagacacatcagataacc
cttcccaagcccatgggaccccgagaaatgcctccgcctaggccaccaaaggttgaactg
gataccaatgtcccaactctgcctaagatgcctgatgcgatctacagccctgctcgtggg
agcatatcgggtgaagtgtccaggccacctatgagtacgccacggggcgtatacagccga
accacatcatcagcttccattcctggcactcccacggcctcatcacagtctcagccagat
tacttttctcctcctacacaaagctactcaaacaacataatcccccctgttcctcctggg
aacgcgatcaaaatcccagaaggagagtctatcacaccagaggaactataccaggccatg
aaggccaaaggtaccattctcataatcgacgttcgggttcgacaagagttcaatgaaggt
cacatcatgtcctcgtcgacgatttgcgtcgaaccaagtatacttcttagggagagtcct
tcggcagatcagatttcagagagtcttataatatcaccaaaccaggaacagtcgctattc
gagcaacgcgacaagtacgatctagttgtcttctatgaccaagattctgaagagattccc
aagcaccctcgaaactcggacgatttggtcattgtttcgcttcatcgagccttggtgcac
ttcaactacccgaaagatctcaggaatcctccaaagatactcaaaggcggcctggatgca
tgggttgatcttatgggtgcagcatctctgcagtcaaacgagccaggaccctcaaaaccg
gtgcaactgcaacgaagccgcaaccgtgccacggcaattgaacgaaggaggtcgaagtac
attgtcaagcctctcagaccagatgaggtcaaggcatggcaagaaacgctcaagaatgac
gatatgcaaacagcgtcctcccccaactttacccgcacaacagaagattttcttaggagg
tttcctcctgtttctctagagcaagagtccatggttgctccagaaaagccgcagcaccga
ccgggctacgggttatctcacaaggtcgacttgtatacagacctaccttcgccgcccacg
cgaccagcccctgccctcccgcggccaagctacagcggcctgactgagggaagggatgag
agcgagctttatggcaacaataacacgcctgccccaggtcgccttgtgagggtgccctcg
gcgaagcccatggagcagcagtcgacaggtgacaccaacaagttctacacggggcttaac
aacccccacaactggtgctatgccaacagcacactgcagagtctccttgcctcgcccgag
tttggccgggagttgtcaaactcgggatgggtggaaagatatcatgcgccgaggaaggat
gatgagaagattgatcatccccaactgatgatacgtatcatctccaacctgttccattgg
atgagctcgggcaagttccaggttatgaaagcccagacactcatggattattcacgtcac
atttgcgatcagggccggagcatcgagcagtttggtggcaaacagcagcaagatgctcaa
gagttcatgtccttcttgctcactcaccttcacgatgagacgaatactcggcgagaccgc
aagggtcaggctgcgcagcccgacacaacgaagcagagcctcctccaggcggcggctgat
tactggcataaccatctcgagtacaaccggtctatagtcgatcgctactggcgcggactc
gagctgtcgacggtcgaatgcttcgagtgtcacacccgtacttatcagttcactcccttc
gactggatccccgtcactgtaggaatgggccgcggcatgacgcttgagcaggttctcgac
cagcacacggcgggcaacaccctcgacgacttttcatgcgaccgctgccgacgtcccacc
cgcgctctccaatccctctcgctcgcccgtctcccctccctgctctgtgtcgtcttccgg
cgtttccactaccaacaggcaacctccgatctgcgcaaatccacggcccctatcacatgg
gatttcaacgataccgatttcacgcgctactttcttccccctgcggatcgcgcggcatgt
tctggtgtcgaacccactgatcctgcgtttacgggtccgttcaggtatgaagcgtatgct
gtcattgttcacacgggcagtcgcatcgacaatggccattacctggcctacgtccgcgac
tcgtcttctcacgacccgtacgcttggtactgctgcaacgactcgcgcgttacaaaggtt
cgcataggccatggcggcagcgacgacgctcaggaagaagtcttcaagtctggccgagat
cgtgtaccttacctcgtcttcttccgccgaaaggggatgcgataa

DBGET integrated database retrieval system