KEGG   Nectria haematococca: NECHADRAFT_67700Help
Entry
NECHADRAFT_67700  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
nhe  Nectria haematococca
Brite
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NECHADRAFT_67700
Peptidases [BR:nhe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NECHADRAFT_67700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 555 aa AA seqDB search
MASISVVVKHQGKKHDVEVDPNSTGEDFKLQMYSLTNVEPERQKILIKGGQLKDDADMSK
LNLKPGQLIMMMGTPASGDIVRPKDAVKFVEDMTEAEQAQQVGATPAGLMNLGNTCYLNS
TLQTLRLIPELQDALSKYTPEQDGTSLLLGGSSNDLAGHLANLYKKMGETQDSFPPLNFL
NALRIVYPQFAEKSKTGHGYAQQDAEEAWTQIVQQLSQKLRIKDEDSSDTSFVQKYMSGE
FSSVMECDEEEARNGGEQPITSTESFGKLNCHIDSSTNHLRDGIIAALSEKLEKNSEVLG
RDAVYTKTSKISRAPKYLTVHFVRFFWKRETQKKAKIMRKVTFPKELDIVEFCSDELKKA
LVPVRDKVREIRKDEEDIERARKRRKKNVDVGDIPGGAGLPSEKEKKEAEKTADGDTVMG
EEGETYKTDAEIEAEKNASLLEAKKELFALINPDLRHDDGANQSGLYELRGVVTHQGASA
DSGHYTSYVKKAAPIDPKTGKKGEEDGKWWWFNDDKVSEVPAEKIDTLAGGGESHSALIL
LYRAIPLPTAEGIEE
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatatcagttgtcgtgaagcatcagggcaagaaacacgatgtcgaggtcgac
ccaaactccaccggcgaggactttaagctccagatgtacagcctgacaaatgtcgagccc
gagcgacaaaagatcctgatcaagggaggacagctcaaagacgatgcggatatgagcaag
ctgaaccttaagcctggtcagctcatcatgatgatgggtacacctgcctctggtgatatc
gtccgacccaaggatgctgtcaagtttgttgaggacatgacggaggctgagcaggctcag
caggtcggcgccacacctgctggcctgatgaacctgggaaacacttgctacctcaactct
acccttcagactctgcgtctgatcccagagcttcaagatgctctgtccaagtacacacct
gagcaagacggcacttccctcctcttgggcggctcttcaaatgatctggccggccacctg
gccaacctgtacaagaagatgggcgagacgcaagattctttcccgcccctgaactttctc
aacgccctacggatcgtctacccccagtttgctgaaaagtccaagacgggacacggctac
gcccagcaggacgctgaggaggcctggacgcagattgttcaacagctgagccagaagctt
cgcatcaaggatgaagactcatccgacacgtcgtttgtgcaaaagtacatgtcgggtgaa
ttctcgtcggttatggagtgtgacgaggaggaagcccgcaacggcggcgagcagcctatt
accagcaccgagagctttggaaagctcaactgtcacatcgacagctcaaccaaccacctg
cgagacggcatcatcgctgctctgagtgagaagttggagaagaactcagaggtcctcggt
cgcgatgccgtctacaccaagacgtccaagatctcgcgggcccccaagtacctcacggtg
cactttgtccgcttcttctggaagcgagagactcagaagaaggccaagatcatgcgaaag
gtgaccttccctaaggagcttgatattgtcgagttctgttcggatgagctgaagaaggct
ctggtccccgttcgtgacaaggtccgtgagattcgcaaggacgaggaggatattgagcgt
gcccgcaagcgacgcaagaagaatgttgatgttggcgacattccaggcggtgccggtctt
ccttctgagaaggagaagaaggaggccgagaagacggctgatggcgacactgtgatggga
gaggagggtgagacctacaagacagacgccgagattgaggctgagaagaatgcctctctc
ttggaggccaagaaggaactctttgccctcatcaaccccgatctccgccatgacgacggt
gcgaaccagtcgggtctgtatgagctccgaggcgttgtgacgcatcagggtgccagtgcc
gacagtggtcactacacttcgtacgtcaagaaggccgcccctatcgaccccaagactggc
aagaagggtgaggaggacggcaagtggtggtggttcaacgacgacaaggtctctgaagta
ccagctgagaagattgataccctcgccggcggtggtgagtctcattccgctctcatcctc
ctgtaccgggccatccctctgcccactgccgagggtatcgaggagtaa

DBGET integrated database retrieval system