KEGG   Nectria haematococca: NECHADRAFT_68543Help
Entry
NECHADRAFT_68543  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nhe  Nectria haematococca
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NECHADRAFT_68543
   00650 Butanoate metabolism
    NECHADRAFT_68543
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NECHADRAFT_68543
   00280 Valine, leucine and isoleucine degradation
    NECHADRAFT_68543
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NECHADRAFT_68543
Enzymes [BR:nhe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NECHADRAFT_68543
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NECHADRAFT_68543
Amino acid related enzymes [BR:nhe01007]
 Aminotransferase (transaminase)
  Class III
   NECHADRAFT_68543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 463 aa AA seqDB search
MPAFVETPKTTVTTEIPGPVSKASTKRLDAIFDARAVHFVVDYDKSHDNYIVDVDGNKYL
DVYAQIASIPVGYNNETLIEAAKSPEMASALVNRPAMGNFPSDQWVDILRNGLMKVAPKG
LSYIFTAQSGSEANELAYKAAFMLYRRRQRGEGVDWNDEEINSCLENSKPGSPELAIMSF
SNSFHGRGFGSLSTTRSKAVHKLDIPSFNWPQAPFPALKYPLEEHTEENAAEEKRCLEEV
ERLITSWHCPVAGLIVEPIQSEGGDNHASPAFFQGLRDITKRHGTCLIADEVQTGFGATG
SFWGHDHWNLTSPPDMVTFSKKAQTAGYFFGNEMLIPDKAYRQFNTWIGDPARVIMCKAV
IQEILDKKLVEQTARVGHHLYNELARLATKYPEYIKNLRGKDQGTFIAFDTKDPAALVRS
MRHIGVNIGTCGKNTVRLRPMLIFEEKHVPILVNAFDKVIGAL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttcgtcgagacccccaagaccaccgtcaccacggagatccctggtcccgtc
tccaaggccagcaccaagcgcctcgatgccatcttcgacgcccgtgctgtccacttcgtg
gttgactacgacaagtcccacgacaactacattgtcgatgttgacggcaacaagtacctc
gatgtctacgcccagatcgcctccatccccgttggctacaacaacgagaccctgatcgag
gctgccaagtcccccgagatggcctctgccctcgtcaaccgacctgccatgggcaacttc
ccctccgaccagtgggttgacatcctccgcaacggcctcatgaaggttgcccccaagggc
ctcagctacatcttcactgctcagtctggctccgaggccaacgagctggcctacaaggct
gccttcatgctctaccgacgccgccagcgtggtgagggtgttgactggaacgatgaggag
atcaactcctgcctcgagaactccaagcctggttcccccgagctcgccatcatgagcttc
agcaactccttccacggccgtggcttcggctctctctccaccacccgctccaaggccgtc
cacaagcttgatatccccagcttcaactggccccaggctcccttccctgccctcaagtac
cctctcgaggagcacactgaggagaatgccgccgaggagaagcgatgcctcgaggaggtt
gagcgcctcatcacctcgtggcactgccccgttgccggtctcatcgttgagcccatccag
tccgagggtggtgacaaccacgcctcccctgccttcttccagggtctccgtgacatcacc
aagcgacacggtacctgcctcatcgccgatgaggtccagactggcttcggtgccactggt
tccttctggggccacgaccactggaacctgacctctccccctgacatggtcaccttctcc
aagaaggcccagactgccggttacttcttcggtaacgagatgctcatccccgacaaggcc
taccgccagttcaacacctggatcggcgaccctgcccgtgtcatcatgtgcaaggctgtc
atccaggagatcctggacaagaagctggttgagcagactgcccgtgtcggccaccacctc
tacaacgagctcgctcgcctggctaccaagtaccccgagtacatcaagaacctccgaggc
aaggaccagggcaccttcatcgccttcgacaccaaggaccctgctgctctcgttcgctcc
atgcgccacattggtgtcaacattggaacttgcggcaagaacactgtccgcctccgaccc
atgctcatcttcgaggagaagcacgttcctatcctcgtcaacgccttcgacaaggtcatt
ggcgctctgtaa

DBGET integrated database retrieval system