KEGG   Nectria haematococca: NECHADRAFT_68573Help
Entry
NECHADRAFT_68573  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K08294  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
nhe  Nectria haematococca
Pathway
nhe04011  MAPK signaling pathway - yeast
nhe04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NECHADRAFT_68573
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    NECHADRAFT_68573
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NECHADRAFT_68573
Protein kinases [BR:nhe01001]
 Serine/threonine kinases: STE group
  STE7 family
   NECHADRAFT_68573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 9673732
NCBI-ProteinID: XP_003051825
JGI: 68573
UniProt: C7YR08
Position
4
AA seq 525 aa AA seqDB search
MADQLPQSSDSTPQPQLPAAITPISLPTPHAGPSPVPLLRPAIPGARSGGARTPRLGLAI
PPSPNAKPVGSQGAPVAAPSRPPLPTLHLKTPMGSNVTPHEQLPRSQCVTQPSASGGSES
SAAHSRSGSFGPLDGRASNPTSAGSQYSALSFASQYGIGVSRPQGTPDPVSAVGSMYSER
SEGGVSMERDGSLQGLEAFDKLSLEKARTLDVDELDEEGWRIASMENRIVELGNLGEGAG
GAVTRCKLKGGNTVFALKVITTNPDPDVKKQILRELGFNKECASDHICRYYGAFVDPATA
TISIAMEFCEGGSLDSIYKEVKRLGGRTGEKVLGKIAEGVLGGLTYLHTRRIIHRDIKPS
NILLCRDGAVKLCDFGVSGDFGTKGEANTFIGTSYYMAPERITGQSYTITSDVWSTGVTL
LEVAQHRFPFPADGTEMQPRAGLIDLLTYIVRQPVPKLKDEPDMDVYWSDNFKYFIECCL
EKQPNRRASPWKMMEHPWMVEMRSKRVNMVKYLSFVWGWDDQPKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaactacctcaaagttctgactcgactcctcaacctcaacttcctgccgcc
attactcccatctctctaccaactcctcacgctggcccctcgcctgtccctctgctccgt
cccgccatccccggcgctaggagtggcggggctcgtacaccgagactcggccttgctatt
cctccatctcccaatgccaaacccgttggcagccaaggcgcaccggttgccgcgccttca
aggcctcctctgccgactctacacctaaagactcccatgggaagcaacgttactccccat
gagcaactccctcgatcacaatgcgttacccaaccatcggcaagcggcggcagcgagagc
agcgctgctcattcaaggtctggtagttttggtcctttggatggtagggcaagcaatcct
acttcggccggctctcagtactcggccctttcattcgcttctcagtatggtattggtgtg
tcaagaccccagggaactccagacccggtgtcggctgttggatccatgtattctgagagg
agtgagggtggtgtttctatggagcgcgatggtagcctgcaaggacttgaggcttttgat
aagctgagcctggagaaggctagaactcttgatgtcgacgagttggatgaggagggttgg
agaatcgccagtatggaaaacagaatcgtggagctgggtaacctgggtgaaggtgcaggc
ggtgctgtcacaagatgcaagctcaagggcggtaacacggtgtttgctttgaaggtcatc
accacgaatcccgatcccgatgtgaagaagcagattcttcgagaacttggtttcaacaag
gaatgcgcctcggaccacatttgtcgatactacggcgcttttgtcgaccccgccacggct
accatctccattgctatggagttctgcgaaggaggctcactcgacagcatctacaaggaa
gtcaagcgtcttggtggccgtactggagaaaaggtcctgggaaagattgccgagggcgtc
ctgggaggactcacttatttgcacacgcgacgaatcattcaccgagacatcaagccatcc
aacattcttctctgccgagatggcgctgtcaagctttgcgactttggcgtctctggcgat
ttcggtaccaagggtgaggccaacacctttatcggtactagctactacatggcccctgaa
cgaatcactggccagtcatacaccatcacttcggatgtgtggtcaacaggagttaccctc
ctcgaggttgcacagcatcgattccccttcccagctgacggcaccgagatgcagccacga
gctggtctcatcgaccttcttacctacattgtcaggcaacctgtgcccaagctcaaggat
gagcctgacatggatgtttactggagtgacaactttaagtactttattgagtgctgtctc
gagaagcagcccaaccgccgagcaagcccctggaagatgatggagcacccatggatggtc
gagatgcgctcaaagcgtgtcaacatggtgaaatacctgtcgtttgtatggggctgggat
gaccagcccaaggcgtag

DBGET integrated database retrieval system