KEGG   Nectria haematococca: NECHADRAFT_68939Help
Entry
NECHADRAFT_68939  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nhe  Nectria haematococca
Pathway
nhe00020  Citrate cycle (TCA cycle)
nhe00310  Lysine degradation
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01130  Biosynthesis of antibiotics
nhe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_68939
  Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_68939
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NECHADRAFT_68939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H DUF5089 Mitofilin
Motif
Other DBs
NCBI-GeneID: 9667283
NCBI-ProteinID: XP_003048111
JGI: 68939
UniProt: C7Z0K8
Position
5
AA seq 437 aa AA seqDB search
MASAIRFKAVAGLAGLSRAIPRTHANAFICHRGAIDTQRRLFGFSRVLNGELIVKVPPMA
ESLNEGTLASLPKKVGETIEADEELASIETDKIDISVPAPETAVIAEYFAAEGDTVVVGQ
DLARIVTGGEASVPKSEGEAQQPPKEEPKQEAKPSEPEKAEENHTKEQTPPHEPPRATKK
PAESKPAPKPEPAAPASAFTEGPARTERVEKMSRMRRTIASRLKQSQNTCASLTTIQEVD
MTNLMAWRAKYKEEVAEKYGVRLGYMGAFTKATTLAALEIPQINAAIDTDKEVTTWRDYV
DISIAVSAPKGLVTPVLRNTHTLSIVELEREVAALAKKARDAKLTMDDLEGGNYSISNPG
IFGSMFGTPVINYPQSAVFNMNGIQQRVMAINGQAEIRPMMYISLTYDHRLIDGREAVSF
LNIVKQYIEDPSRMLLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctatacgattcaaggccgtcgctggcctcgccggcctctcgcgcgcaatc
cctcgaacccatgcgaatgccttcatctgccatcgcggcgcaatcgacacccagcgtcgc
ctgtttggcttctcgagagtcctcaatggcgagctcatcgtcaaggtgcccccgatggct
gagtcccttaacgagggcacactggccagcttgcccaagaaagtcggcgagaccattgag
gccgacgaggaacttgccagcatcgagaccgacaagatcgacatttccgttcctgccccc
gagactgccgtcatagccgaatactttgctgccgagggagatactgttgttgttggtcaa
gaccttgcgcgcatcgtgacgggcggcgaggccagcgttcctaagagcgagggagaggct
caacagccacccaaggaggagcccaagcaagaggcgaagccatccgagcctgaaaaggcc
gaagagaaccataccaaggagcagacgcctcctcatgagcctcccagagccacgaagaag
cctgccgagtcgaagcctgcacccaagcccgaacctgccgctcccgcgagcgcattcacc
gaaggtcccgcaagaactgaacgagttgagaaaatgagccgtatgcgacggaccatcgca
agccgcctcaagcagtcccaaaacacatgcgcctccctcaccaccatccaagaagtcgac
atgaccaacctcatggcatggcgagccaagtacaaggaagaagttgccgagaagtacggt
gtgcgccttggttacatgggtgcctttaccaaggccactactctagctgctttggagatt
cctcagatcaacgctgccattgacacagacaaggaggttactacatggcgagactatgtc
gatatcagtatcgctgtttcagcgcccaagggtcttgtgacacctgtgttgaggaacaca
catactctgagcattgttgagctggagcgagaggttgctgctctggccaagaaggcccgc
gatgcaaagctcaccatggacgatctcgaaggcggcaactactccatcagcaaccccggt
atctttggttccatgtttggtacccccgtcatcaactacccccagtctgccgtcttcaac
atgaacggtatccaacagcgtgtcatggccatcaacggccaggccgaaattcgacctatg
atgtacattagcttgacgtatgatcaccgtctcattgatggtcgggaggctgtcagcttc
ctcaacattgtaaagcagtatatcgaggatccttctcggatgcttctcgcttaa

DBGET integrated database retrieval system