KEGG   Nectria haematococca: NECHADRAFT_68939Help
Entry
NECHADRAFT_68939  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nhe  Nectria haematococca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NECHADRAFT_68939
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_68939
  Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_68939
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NECHADRAFT_68939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 437 aa AA seqDB search
MASAIRFKAVAGLAGLSRAIPRTHANAFICHRGAIDTQRRLFGFSRVLNGELIVKVPPMA
ESLNEGTLASLPKKVGETIEADEELASIETDKIDISVPAPETAVIAEYFAAEGDTVVVGQ
DLARIVTGGEASVPKSEGEAQQPPKEEPKQEAKPSEPEKAEENHTKEQTPPHEPPRATKK
PAESKPAPKPEPAAPASAFTEGPARTERVEKMSRMRRTIASRLKQSQNTCASLTTIQEVD
MTNLMAWRAKYKEEVAEKYGVRLGYMGAFTKATTLAALEIPQINAAIDTDKEVTTWRDYV
DISIAVSAPKGLVTPVLRNTHTLSIVELEREVAALAKKARDAKLTMDDLEGGNYSISNPG
IFGSMFGTPVINYPQSAVFNMNGIQQRVMAINGQAEIRPMMYISLTYDHRLIDGREAVSF
LNIVKQYIEDPSRMLLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctatacgattcaaggccgtcgctggcctcgccggcctctcgcgcgcaatc
cctcgaacccatgcgaatgccttcatctgccatcgcggcgcaatcgacacccagcgtcgc
ctgtttggcttctcgagagtcctcaatggcgagctcatcgtcaaggtgcccccgatggct
gagtcccttaacgagggcacactggccagcttgcccaagaaagtcggcgagaccattgag
gccgacgaggaacttgccagcatcgagaccgacaagatcgacatttccgttcctgccccc
gagactgccgtcatagccgaatactttgctgccgagggagatactgttgttgttggtcaa
gaccttgcgcgcatcgtgacgggcggcgaggccagcgttcctaagagcgagggagaggct
caacagccacccaaggaggagcccaagcaagaggcgaagccatccgagcctgaaaaggcc
gaagagaaccataccaaggagcagacgcctcctcatgagcctcccagagccacgaagaag
cctgccgagtcgaagcctgcacccaagcccgaacctgccgctcccgcgagcgcattcacc
gaaggtcccgcaagaactgaacgagttgagaaaatgagccgtatgcgacggaccatcgca
agccgcctcaagcagtcccaaaacacatgcgcctccctcaccaccatccaagaagtcgac
atgaccaacctcatggcatggcgagccaagtacaaggaagaagttgccgagaagtacggt
gtgcgccttggttacatgggtgcctttaccaaggccactactctagctgctttggagatt
cctcagatcaacgctgccattgacacagacaaggaggttactacatggcgagactatgtc
gatatcagtatcgctgtttcagcgcccaagggtcttgtgacacctgtgttgaggaacaca
catactctgagcattgttgagctggagcgagaggttgctgctctggccaagaaggcccgc
gatgcaaagctcaccatggacgatctcgaaggcggcaactactccatcagcaaccccggt
atctttggttccatgtttggtacccccgtcatcaactacccccagtctgccgtcttcaac
atgaacggtatccaacagcgtgtcatggccatcaacggccaggccgaaattcgacctatg
atgtacattagcttgacgtatgatcaccgtctcattgatggtcgggaggctgtcagcttc
ctcaacattgtaaagcagtatatcgaggatccttctcggatgcttctcgcttaa

DBGET integrated database retrieval system