KEGG   Nectria haematococca: NECHADRAFT_68939Help
Entry
NECHADRAFT_68939  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nhe  Nectria haematococca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NECHADRAFT_68939
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECHADRAFT_68939
  Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_68939
Enzymes [BR:nhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NECHADRAFT_68939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 437 aa AA seqDB search
MASAIRFKAVAGLAGLSRAIPRTHANAFICHRGAIDTQRRLFGFSRVLNGELIVKVPPMA
ESLNEGTLASLPKKVGETIEADEELASIETDKIDISVPAPETAVIAEYFAAEGDTVVVGQ
DLARIVTGGEASVPKSEGEAQQPPKEEPKQEAKPSEPEKAEENHTKEQTPPHEPPRATKK
PAESKPAPKPEPAAPASAFTEGPARTERVEKMSRMRRTIASRLKQSQNTCASLTTIQEVD
MTNLMAWRAKYKEEVAEKYGVRLGYMGAFTKATTLAALEIPQINAAIDTDKEVTTWRDYV
DISIAVSAPKGLVTPVLRNTHTLSIVELEREVAALAKKARDAKLTMDDLEGGNYSISNPG
IFGSMFGTPVINYPQSAVFNMNGIQQRVMAINGQAEIRPMMYISLTYDHRLIDGREAVSF
LNIVKQYIEDPSRMLLA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctatacgattcaaggccgtcgctggcctcgccggcctctcgcgcgcaatc
cctcgaacccatgcgaatgccttcatctgccatcgcggcgcaatcgacacccagcgtcgc
ctgtttggcttctcgagagtcctcaatggcgagctcatcgtcaaggtgcccccgatggct
gagtcccttaacgagggcacactggccagcttgcccaagaaagtcggcgagaccattgag
gccgacgaggaacttgccagcatcgagaccgacaagatcgacatttccgttcctgccccc
gagactgccgtcatagccgaatactttgctgccgagggagatactgttgttgttggtcaa
gaccttgcgcgcatcgtgacgggcggcgaggccagcgttcctaagagcgagggagaggct
caacagccacccaaggaggagcccaagcaagaggcgaagccatccgagcctgaaaaggcc
gaagagaaccataccaaggagcagacgcctcctcatgagcctcccagagccacgaagaag
cctgccgagtcgaagcctgcacccaagcccgaacctgccgctcccgcgagcgcattcacc
gaaggtcccgcaagaactgaacgagttgagaaaatgagccgtatgcgacggaccatcgca
agccgcctcaagcagtcccaaaacacatgcgcctccctcaccaccatccaagaagtcgac
atgaccaacctcatggcatggcgagccaagtacaaggaagaagttgccgagaagtacggt
gtgcgccttggttacatgggtgcctttaccaaggccactactctagctgctttggagatt
cctcagatcaacgctgccattgacacagacaaggaggttactacatggcgagactatgtc
gatatcagtatcgctgtttcagcgcccaagggtcttgtgacacctgtgttgaggaacaca
catactctgagcattgttgagctggagcgagaggttgctgctctggccaagaaggcccgc
gatgcaaagctcaccatggacgatctcgaaggcggcaactactccatcagcaaccccggt
atctttggttccatgtttggtacccccgtcatcaactacccccagtctgccgtcttcaac
atgaacggtatccaacagcgtgtcatggccatcaacggccaggccgaaattcgacctatg
atgtacattagcttgacgtatgatcaccgtctcattgatggtcgggaggctgtcagcttc
ctcaacattgtaaagcagtatatcgaggatccttctcggatgcttctcgcttaa

DBGET integrated database retrieval system