KEGG   Nectria haematococca: NECHADRAFT_69011Help
Entry
NECHADRAFT_69011  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 9671958
NCBI-ProteinID: XP_003048153
JGI: 69011
UniProt: C7Z0T9
Position
5
AA seq 106 aa AA seqDB search
MAGGDVKKGANLFKTRCAQCHTVEKDGGNKIGPALHGLFGRKSGTVEGYAYTDANKQKGV
EWNDQTLFDYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDSCA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggcgacgtcaagaagggtgccaacctgttcaagacccgatgtgctcagtgc
cacaccgttgagaaggacggcggcaacaagatcggccctgccctgcacggcctcttcggc
cgcaagagtggtaccgtcgagggctacgcctacaccgacgccaacaagcagaagggtgtc
gagtggaacgaccagaccctcttcgactacctcgagaaccccaagaagtacatccccggc
accaagatggctttcggtggcctgaagaaggccaaggaccgaaacgacctcattgcctac
ctcaaggactcttgtgcttaa

DBGET integrated database retrieval system