KEGG   Nectria haematococca: NECHADRAFT_69011Help
Entry
NECHADRAFT_69011  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
nhe  Nectria haematococca
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NECHADRAFT_69011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 106 aa AA seqDB search
MAGGDVKKGANLFKTRCAQCHTVEKDGGNKIGPALHGLFGRKSGTVEGYAYTDANKQKGV
EWNDQTLFDYLENPKKYIPGTKMAFGGLKKAKDRNDLIAYLKDSCA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggcgacgtcaagaagggtgccaacctgttcaagacccgatgtgctcagtgc
cacaccgttgagaaggacggcggcaacaagatcggccctgccctgcacggcctcttcggc
cgcaagagtggtaccgtcgagggctacgcctacaccgacgccaacaagcagaagggtgtc
gagtggaacgaccagaccctcttcgactacctcgagaaccccaagaagtacatccccggc
accaagatggctttcggtggcctgaagaaggccaaggaccgaaacgacctcattgcctac
ctcaaggactcttgtgcttaa

DBGET integrated database retrieval system