KEGG   Nectria haematococca: NECHADRAFT_69390Help
Entry
NECHADRAFT_69390  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
nhe  Nectria haematococca
Pathway
nhe00860  Porphyrin and chlorophyll metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NECHADRAFT_69390
Enzymes [BR:nhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NECHADRAFT_69390
Exosome [BR:nhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NECHADRAFT_69390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 9667874
NCBI-ProteinID: XP_003051179
JGI: 69390
UniProt: C7YRI7
Position
5
AA seq 386 aa AA seqDB search
MSFSSLVQDLSLRDTNAARRPQIPGPRSSVSTLDDRASHISRAMSYASTAATSVSISGDI
SSQLHGGYFHPLARSWQAERQLTKSMLIYPIFVTDGEGDMILVPSLPGQHQLSVDKLVPF
LEPLVHKGLRSVMLFGVPMRNGTKDALGTAADDPEGPVIKAIQLIRRRFPQLFICCDVCL
CEYTSHGHCGILRDDGSLNNQLSVDRISDVAIAYAKAGAHCVAPSDMNDGRIRAIKLKLI
EEGIAHKTVLMSYSAKFSGCLYGPFRDAAGSAPSFGDRKCYQLPPGGRGLARRALVRDIN
EGADIIMVKPASQYLDIISDAKELGKDLPVAAYQVSGEYAMIHAGAKAGVFDLKAMAFES
TEGILRAGATIVVSYFTPDFLDWLEN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctccagccttgttcaggacctgagcctccgcgacaccaatgccgctcgccgc
cctcagattccaggccctcgctcttccgtctccactcttgacgaccgagcatcgcacatc
tcgcgggccatgtcctacgccagcaccgccgcaaccagcgtcagcatttcgggcgacatc
tcgagccagcttcatggcggatactttcaccctctggcccgctcctggcaggcagagcgt
cagctcaccaagtcgatgctcatctaccccatctttgtcaccgatggcgaaggcgacatg
atcctcgttccctctctccctggccagcaccagcttagcgtcgacaagttggtccccttc
ctcgagcctctcgtccacaagggcctgcgctcagttatgctctttggtgtccccatgcga
aatggcaccaaggacgctctgggcaccgccgccgatgaccccgagggtcctgtcatcaag
gctatccagcttatccgccgacgtttcccccagctcttcatctgctgcgatgtctgcctc
tgcgagtacacttcccacggccactgcggtatcctgcgcgacgacggcagcctcaacaac
cagctgtctgttgaccgtatctcggatgtcgccattgcctacgccaaggccggagctcac
tgtgttgctccctcagacatgaacgatggtcgcattcgcgccatcaagctcaagctgatt
gaggagggcattgctcacaagaccgtgctcatgtcgtactcggccaagttctctggctgc
ttgtacggtcctttccgagacgctgctggatctgcgccttcatttggtgaccgcaagtgc
taccagctcccccctggtggccgtggtcttgcccgacgagctcttgtccgagacatcaac
gagggtgccgacatcatcatggtgaagcctgcaagccagtacctcgacattatcagtgac
gccaaggagctgggcaaggatctccccgtggccgcctaccaggtcagcggtgagtacgcc
atgatccatgctggagccaaggcgggtgtgtttgacctcaaggccatggcatttgagtca
acggagggtatcctccgagccggagccacgattgtggtcagctacttcacccctgacttc
cttgactggctcgagaactaa

DBGET integrated database retrieval system