KEGG   Nectria haematococca: NECHADRAFT_69616Help
Entry
NECHADRAFT_69616  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 419 aa AA seqDB search
MSDLQGRKVFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPDALDLLDKMLAFDPS
SRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGQMRSMILDEVMRFRQLVRT
VPGQGGASGAPGQQGGAQVPMPQAGNQWTAEDPRPQEYVGHGHAGLEQDLQGGLDASRR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacctccaaggacggaaggtcttcaaggtcttcaaccaggactttatcgtcgat
gagcgctacaccgtcaccaaggagcttggacagggcgcctacggtatcgtctgtgctgcc
gtcaacaaccagaccaacgaaggcgtcgctatcaagaaggtcacaaatgtctttagcaag
aagattctcgccaagcgcgccctgcgcgagatcaagctgctccagcactttcgcggtcac
cgcaacatcacatgtctgtacgacatggacattcctcgacccgacaactttaacgagacg
tacctgtacgaggagctgatggagtgcgatctggcggccatcatccgttctggccagccc
ctcaccgatgcccacttccagtccttcatttaccagatcctgtgcggtctcaagtacatc
cactcggccaacgtcctgcaccgagatctcaagcccggaaacctgctggtcaatgccgac
tgcgagctcaagatttgcgatttcggtctggctcgaggcttctcggtcgaccctgaggag
aatgccggctacatgaccgaatacgtcgctactcgatggtaccgagcccctgagattatg
ctgagcttccagagctacaccaaagctattgatgtttggtccgttggctgtattctggcc
gagctgctgggcggccgacccttcttcaagggtcgcgattacgttgaccagctgaaccag
atcctccacatcctcggaacccccaacgaggagacgctctcgcgcattggatctccccga
gcccaggaatacgtgcgcaacctgccattcatgcccaagaaacctttccccagcctgttc
ccccaggccaacccagacgccctcgatcttctcgacaagatgctcgcctttgacccctcg
tcccgtatcagcgtggagcaggctcttgagcacccctacctgcacatctggcacgacgcc
tcggacgagcccgactgccccaccaccttcaacttcgactttgaggtggttgaggatgtt
ggtcagatgcgcagcatgatcttggacgaggtgatgcgattccgacagctcgtccgcacc
gttcccggacagggtggtgctagcggtgctcctggccagcagggcggcgcccaggtcccc
atgccccaagccggcaaccagtggactgctgaggatcctcgaccgcaagaatatgtcggt
cacggacacgcgggactcgagcaggatctccagggtggcctcgacgcatcgaggaggtag

DBGET integrated database retrieval system