KEGG   Nectria haematococca: NECHADRAFT_69616Help
Entry
NECHADRAFT_69616  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
nhe  Nectria haematococca
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NECHADRAFT_69616
Enzymes [BR:nhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NECHADRAFT_69616
Protein kinases [BR:nhe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NECHADRAFT_69616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 419 aa AA seqDB search
MSDLQGRKVFKVFNQDFIVDERYTVTKELGQGAYGIVCAAVNNQTNEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPDALDLLDKMLAFDPS
SRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGQMRSMILDEVMRFRQLVRT
VPGQGGASGAPGQQGGAQVPMPQAGNQWTAEDPRPQEYVGHGHAGLEQDLQGGLDASRR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacctccaaggacggaaggtcttcaaggtcttcaaccaggactttatcgtcgat
gagcgctacaccgtcaccaaggagcttggacagggcgcctacggtatcgtctgtgctgcc
gtcaacaaccagaccaacgaaggcgtcgctatcaagaaggtcacaaatgtctttagcaag
aagattctcgccaagcgcgccctgcgcgagatcaagctgctccagcactttcgcggtcac
cgcaacatcacatgtctgtacgacatggacattcctcgacccgacaactttaacgagacg
tacctgtacgaggagctgatggagtgcgatctggcggccatcatccgttctggccagccc
ctcaccgatgcccacttccagtccttcatttaccagatcctgtgcggtctcaagtacatc
cactcggccaacgtcctgcaccgagatctcaagcccggaaacctgctggtcaatgccgac
tgcgagctcaagatttgcgatttcggtctggctcgaggcttctcggtcgaccctgaggag
aatgccggctacatgaccgaatacgtcgctactcgatggtaccgagcccctgagattatg
ctgagcttccagagctacaccaaagctattgatgtttggtccgttggctgtattctggcc
gagctgctgggcggccgacccttcttcaagggtcgcgattacgttgaccagctgaaccag
atcctccacatcctcggaacccccaacgaggagacgctctcgcgcattggatctccccga
gcccaggaatacgtgcgcaacctgccattcatgcccaagaaacctttccccagcctgttc
ccccaggccaacccagacgccctcgatcttctcgacaagatgctcgcctttgacccctcg
tcccgtatcagcgtggagcaggctcttgagcacccctacctgcacatctggcacgacgcc
tcggacgagcccgactgccccaccaccttcaacttcgactttgaggtggttgaggatgtt
ggtcagatgcgcagcatgatcttggacgaggtgatgcgattccgacagctcgtccgcacc
gttcccggacagggtggtgctagcggtgctcctggccagcagggcggcgcccaggtcccc
atgccccaagccggcaaccagtggactgctgaggatcctcgaccgcaagaatatgtcggt
cacggacacgcgggactcgagcaggatctccagggtggcctcgacgcatcgaggaggtag

DBGET integrated database retrieval system