KEGG   Nectria haematococca: NECHADRAFT_69753Help
Entry
NECHADRAFT_69753  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
nhe  Nectria haematococca
Pathway
nhe00630  Glyoxylate and dicarboxylate metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
nhe01200  Carbon metabolism
Module
nhe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NECHADRAFT_69753
Enzymes [BR:nhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NECHADRAFT_69753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL
Motif
Other DBs
NCBI-GeneID: 9666346
NCBI-ProteinID: XP_003051438
JGI: 69753
UniProt: C7YSX7
Position
5
AA seq 599 aa AA seqDB search
MMRRISTRAPRQLLSIASKPRGPALFLAARALSTSSVARMPLHSSHATQPADAFQLLPES
QKAGEAEDRLYEATVKEIEAWWASPRYEGIRRPYSAADVASKRGTQKIQYPSSVMAQKLF
NLVQERQAKGEPIHTMGAIDPVQMTQQAPHQEVLYISGWACSSLLTSTNEVSPDFGDYPY
NTVPNQVQRLAKAQNMHDRKQWDLRRKMTPEERAKTPYTDYLRPIVADGDTGHGGLSAVL
KLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIGEHINRLVAARFQWDVMGCENLV
IARTDSESGKLLSSAIDVRDHEFILGVADPSIEPLAETIQAMEAEGAVGTEIDAFEANWV
KNTKLVSFDEAAVAHMQKEGVAQAQIDEYLAETAKDRDMGISRRRHLADKYTKTPVYFNW
DVPRTREGFYHYRAGMDAATKRALAFSPYADLLWVETGDPNVEVAAKLGRTVREVNPGKG
LVYNLSPSFNWMAHGFTDETLKSFIWDIAREGFVLQLISLAGLHSNATITTELARNFKTE
GMKAYVDLVQRREKDLNCDVLTHQKWSGASYIDGILGAIQSGSSSSKSMGEGNTEGQFH
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcagaatatccactcgagctcctcggcaattgctctctatcgcctccaagcct
agaggtcccgccctcttcctcgccgcccgcgctctgtccacctcgtctgtcgccagaatg
cccctccacagcagccacgcgactcagcctgccgatgccttccagcttctccctgagtcg
caaaaggctggtgaggctgaagaccgtctgtacgaggctaccgtcaaggagattgaggcc
tggtgggcgtcgcctcgttatgagggcatcaggcgtccttacagcgctgctgatgtcgcc
tccaagcgcggcacgcaaaagatccaatatcccagctccgtcatggctcaaaagctcttt
aacctcgtccaagagcgccaggccaagggcgagcccatccacaccatgggcgctatcgat
cccgtccagatgacccagcaggcccctcaccaagaggttctctacatctccggctgggcc
tgctcctccctcctcacctcgaccaacgaagtttctcccgactttggcgactacccctac
aacacagtccccaaccaggtccagcgcctggccaaggcccagaacatgcacgaccgcaag
cagtgggatctccgtcgcaagatgactcccgaggagcgcgcaaagactccctacactgac
tacctccgccccatcgtcgccgacggtgataccggccatggtggtctctctgctgttctc
aagcttgccaagctgtttgctgagaatggtgccgctgctgttcactttgaggatcagctc
catggcggcaagaagtgtggtcacttggctggaaaggttctcgtccccatcggtgagcac
atcaaccgtcttgtcgccgcccgtttccaatgggacgtcatgggctgcgagaacctcgtc
attgcccgaaccgactccgagtctggcaagctcctctcctcggccatcgatgtccgcgac
cacgagttcatcctcggtgtcgcggatccctcgatcgagccccttgccgagaccatccag
gctatggaggccgagggtgctgttggcaccgagattgatgctttcgaggccaactgggtc
aagaacaccaagctcgtcagctttgacgaggccgccgtcgcgcacatgcagaaggagggt
gtcgctcaagcccagattgacgagtacctcgccgagactgccaaggaccgcgatatgggc
atctctcgccgtcgccaccttgccgacaagtacaccaagacgcctgtctacttcaactgg
gacgtcccacgaacccgtgagggcttctaccactaccgcgccggcatggacgctgccacc
aagcgtgcgctcgccttcagcccctatgccgacctcctctgggtcgagactggcgacccc
aacgtcgaggtggccgccaagctcggccgtacggtccgcgaggtgaaccctggcaagggt
ctcgtgtacaacctgtctccttcattcaactggatggcccacggcttcactgatgagacg
ctcaagtcgttcatctgggacattgcccgcgagggctttgttctgcagctcatctccctg
gctggtcttcactctaacgcgaccatcacgacagagctggctcgcaacttcaagacggag
ggtatgaaggcgtacgttgatcttgtgcagcgtcgtgagaaggatctcaactgcgatgtc
ttgacgcatcagaagtggagcggtgctagctacattgatggcatcctaggagccatccag
agcggcagctccagcagcaagagcatgggcgagggtaacactgagggacaattccattag

DBGET integrated database retrieval system