KEGG   Nectria haematococca: NECHADRAFT_70041Help
Entry
NECHADRAFT_70041  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
nhe  Nectria haematococca
Pathway
nhe00860  Porphyrin and chlorophyll metabolism
nhe01100  Metabolic pathways
nhe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NECHADRAFT_70041
Enzymes [BR:nhe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     NECHADRAFT_70041
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     NECHADRAFT_70041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M Pyr_redox_3 TrkA_N Cytotoxic ELFV_dehydrog
Motif
Other DBs
NCBI-GeneID: 9673498
NCBI-ProteinID: XP_003045060
JGI: 70041
UniProt: C7Z929
Position
6
AA seq 257 aa AA seqDB search
MAKTYPPVQPGGSLILAWQIKQKKVLVVGGGDVAAGRILNCLNADAKVVVVCPKSGLNDE
VAYRIREGQVTHVNRLFEPQDLDGAEMVLVAVDDPAASTVIWKLCKERRIPANIADVPPE
CDFYFGSIHRDGPLQIMVSTNGKGPRLAAAIRQFIAKQLPKNAGNAIETIGELRLRLRKV
APRPEDGPKRMLWMSKVSDTYKWDEMCGLTDEDMDNLLLFYPANKVPSMDVLVALRGGTD
IKKLDVFDGSFGFSVGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgtatcctcccgtgcagcccggaggcagcttgatcctggcatggcagatt
aagcagaagaaggtgctcgtcgttggcggcggtgatgtcgccgccggtcgcatcctcaac
tgcctcaatgccgatgcaaaagttgtcgtcgtctgccccaagtccggtctcaatgacgaa
gtcgcctaccgaatccgcgagggccaggtcacacatgtcaaccgcctgttcgaaccccaa
gacctcgatggagccgagatggtgctggtagctgtcgacgatcccgccgcatcgaccgtc
atctggaaactgtgcaaggaacgaaggatccccgccaacatcgccgacgtaccacccgag
tgcgacttttactttggcagcattcaccgagatgggccgctacagatcatggttagcacc
aacggaaagggaccgaggttggcggccgccatcagacagttcatcgccaagcagctcccc
aagaatgccggcaatgcgatcgagactatcggtgagctgaggctcaggttgagaaaggtt
gctcccaggcctgaggatggacccaagcgcatgctatggatgtccaaggtcagcgacacc
tacaaatgggacgagatgtgcggactcacggacgaggatatggataacctgctactcttc
tacccggccaacaaggtcccctcgatggatgtgttggtagctcttcgtggaggcaccgac
attaagaaactcgacgttttcgacggatccttcggcttcagcgtgggagcataa

DBGET integrated database retrieval system