KEGG   Nectria haematococca: NECHADRAFT_70041Help
Entry
NECHADRAFT_70041  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K02304  
precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
nhe  Nectria haematococca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nhe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 257 aa AA seqDB search
MAKTYPPVQPGGSLILAWQIKQKKVLVVGGGDVAAGRILNCLNADAKVVVVCPKSGLNDE
VAYRIREGQVTHVNRLFEPQDLDGAEMVLVAVDDPAASTVIWKLCKERRIPANIADVPPE
CDFYFGSIHRDGPLQIMVSTNGKGPRLAAAIRQFIAKQLPKNAGNAIETIGELRLRLRKV
APRPEDGPKRMLWMSKVSDTYKWDEMCGLTDEDMDNLLLFYPANKVPSMDVLVALRGGTD
IKKLDVFDGSFGFSVGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgtatcctcccgtgcagcccggaggcagcttgatcctggcatggcagatt
aagcagaagaaggtgctcgtcgttggcggcggtgatgtcgccgccggtcgcatcctcaac
tgcctcaatgccgatgcaaaagttgtcgtcgtctgccccaagtccggtctcaatgacgaa
gtcgcctaccgaatccgcgagggccaggtcacacatgtcaaccgcctgttcgaaccccaa
gacctcgatggagccgagatggtgctggtagctgtcgacgatcccgccgcatcgaccgtc
atctggaaactgtgcaaggaacgaaggatccccgccaacatcgccgacgtaccacccgag
tgcgacttttactttggcagcattcaccgagatgggccgctacagatcatggttagcacc
aacggaaagggaccgaggttggcggccgccatcagacagttcatcgccaagcagctcccc
aagaatgccggcaatgcgatcgagactatcggtgagctgaggctcaggttgagaaaggtt
gctcccaggcctgaggatggacccaagcgcatgctatggatgtccaaggtcagcgacacc
tacaaatgggacgagatgtgcggactcacggacgaggatatggataacctgctactcttc
tacccggccaacaaggtcccctcgatggatgtgttggtagctcttcgtggaggcaccgac
attaagaaactcgacgttttcgacggatccttcggcttcagcgtgggagcataa

DBGET integrated database retrieval system