KEGG   Nectria haematococca: NECHADRAFT_70914Help
Entry
NECHADRAFT_70914  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nhe  Nectria haematococca
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NECHADRAFT_70914
  Lipid metabolism
   00062 Fatty acid elongation
    NECHADRAFT_70914
Enzymes [BR:nhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NECHADRAFT_70914
Lipid biosynthesis proteins [BR:nhe01004]
 Fatty acid synthase
  Component type
   NECHADRAFT_70914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 333 aa AA seqDB search
MLYPSLLRLGLATGLLAGHGYTAPAHATDDIDDTPLPVVVWHGLGDYVHSDSMKAVEELI
ESANPGTFVYVIAVDQSSEQDRTATFTGNVSAQIEQVCEELAKHSILSTAPAIDAVGISQ
GGQFLRGYVERCNWPQVRSLVTFGSQHNGISKFRVCGDNDWICKGAMALLKFNVWSSFVQ
SRLIPAQYFRDPQSPDYERYLEHSNFLADINNERELKNEKYKANLGSLTNFVMWMFESDT
MVSPKESSWFEEVNGTEVTPLRARQLYREDWIGLRELDRKGGLRFRVAPGDHLENMGELL
NKTAAEFFGPWRKTFKSDMENPTGDGLFEAEEL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctctacccttccctgctccgccttggcctggccacggggcttctggctggccatggc
tataccgcgcccgcccacgcgactgacgatatagacgacactccacttcccgttgttgtt
tggcatggccttggtgactatgtccacagcgacagcatgaaggccgtggaggaactcatc
gagtctgccaaccccggcacatttgtctatgtaattgctgtcgatcagagctccgaacaa
gaccgcaccgccaccttcacaggcaacgtctcggcccaaatcgagcaagtttgcgaggag
ctcgccaagcattccatcttgtctacggcaccggccattgatgctgtcggcatctcccag
ggtggtcagttcctgcgtggctacgtcgagcgatgcaactggccccaggttcgcagtctc
gtcacctttggcagccagcacaatggtatctccaagttcagagtttgcggagacaacgac
tggatctgcaagggagctatggcgcttcttaagttcaacgtctggagcagctttgttcag
tcacgtcttatccccgcccaatacttccgtgacccccagagcccggactacgaacgttat
ctcgagcattccaacttcctcgccgatatcaacaacgaacgcgagctcaagaacgaaaag
tacaaggcgaaccttggtagcttgaccaactttgtcatgtggatgtttgagagcgacacc
atggtttcccccaaggagtcgtcttggtttgaggaggtcaacggtaccgaggtcactcca
ttgagagcccgccagctctaccgcgaggactggattggtctgcgcgagcttgaccgcaag
ggtggtcttcgattccgagttgcacctggtgaccacctcgagaacatgggcgaacttctc
aacaagacagcggccgagttctttggcccttggcgaaagacgttcaagtctgacatggag
aaccctaccggagacggtctctttgaggcggaggagctatag

DBGET integrated database retrieval system