KEGG   Nectria haematococca: NECHADRAFT_71780Help
Entry
NECHADRAFT_71780  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
nhe  Nectria haematococca
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nhe04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 375 aa AA seqDB search
MVLIKSFVLSALAATVAAKSAVIELLPSNFDNVVLKSGKPTLVEFFAPWCGHCKKLAPVW
EELAFAYEPTGKVQIAKVDADAHRELGKRFGIQGFPTLKFFDGKSDKPQEYKSGRDLESL
TEFLAEKTGVKPKKKLELPSEVAILNDGSFAELIGGDKNVLVAFTAPWCGHCKNLAPTWE
EVATDFINDKNVVIAKVDAEAPNSKAVTEQQGVKSYPTIKWFPAGSKEAVAYEGGRSEEA
ILAWVNKHAGTHRVPGGGLNAIAGTVESLDTLVAKIAGGAALAEVAAEVKKEVEGLTDAI
QQKYAEYYVRVFDKLSQNNDWASKELTRLDGILSKGGLAPSKRDQIQQKTNVLRKFLEKA
EEKVEEKVEEVKDEL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgatcaagagcttcgtgctctcggccctcgccgctacggtggcagccaagtcg
gccgttatcgagctcctcccctccaacttcgacaacgtcgtcctcaagtccggcaagccc
acgctcgtcgaattctttgcgccatggtgcggccactgcaagaagctcgcccccgtctgg
gaggagcttgcgtttgcctacgagcccaccggcaaggtccagatcgccaaggtcgacgcc
gacgcccaccgcgagctcggaaagcgattcggcatccagggcttccctacgctcaagttc
tttgacggaaagagcgacaagccccaagagtacaagtctggccgcgacctcgagagcctt
accgagtttcttgctgagaagactggtgtcaagcccaagaagaagcttgagctgcccagc
gaggttgccatcttgaacgatggttccttcgccgagctcattggtggagacaagaacgtc
ctggttgcctttaccgctccttggtgtggccactgcaagaaccttgctcccacctgggag
gaggttgcgaccgacttcatcaacgacaagaatgttgtgattgccaaggttgatgctgag
gctcccaacagcaaggccgtcaccgagcagcagggcgtcaagtcctaccccaccatcaag
tggttccctgccggcagcaaggaggctgtcgcctacgagggaggtcgcagcgaggaggcc
atccttgcttgggttaacaagcacgctggaactcaccgtgttcccggcggtggcctgaac
gccattgctggcactgttgagtctcttgacactcttgtcgccaagatcgccggtggcgcc
gctcttgctgaggttgccgccgaggtcaagaaggaggtcgagggcctcacagacgctatt
cagcagaagtacgccgagtactacgtccgtgtgtttgataagcttagccagaacaacgac
tgggcgtccaaggagctcacccgactggatggcatcttgtccaagggcgggctggcccca
tccaagcgagaccagatccagcagaagaccaacgtcctccgcaagttcctcgagaaggcc
gaggagaaggttgaggagaaggtcgaggaggtcaaggatgagctataa

DBGET integrated database retrieval system